Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4HB88

Protein Details
Accession A0A2T4HB88    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
258-279ALLRKLRYVPPKKPRVKSVTKYHydrophilic
NLS Segment(s)
PositionSequence
269-270KK
Subcellular Location(s) nucl 17.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
Amino Acid Sequences MAQPANIPGLELKPGTLGRQIFPEFRFTETDSPDVIKCYPTFVFHPVYKEFSLDEHRFADYMLLNRNSDRPSKAVTELPKRNTLKLLSGKGVEICVGKTPSEDETWSLPVNLVSHHSAYFKAACLWNVKGQINLLGHDPAVFSLFVEWMYNGSYDISAFPRNPSMHAKCWVLGDFILCRKFKNYAMGRLFDEHVATAFGIPVAYEDVQYVCDSASSDSKLKLFYTDFVTDQFGDIYRLRGYMADWEKFLEDHPKTRSALLRKLRYVPPKKPRVKSVTKYLEPEEVVSESALRAQVDFARFAEKKQDEVPKPATQNEVSKPACQDDSEKRVSTNPYYMPSLTYHTLDKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.23
4 0.24
5 0.22
6 0.29
7 0.32
8 0.32
9 0.33
10 0.38
11 0.33
12 0.34
13 0.36
14 0.33
15 0.36
16 0.35
17 0.36
18 0.3
19 0.31
20 0.29
21 0.29
22 0.25
23 0.22
24 0.19
25 0.21
26 0.21
27 0.22
28 0.24
29 0.26
30 0.31
31 0.3
32 0.35
33 0.33
34 0.37
35 0.34
36 0.32
37 0.28
38 0.26
39 0.32
40 0.29
41 0.3
42 0.26
43 0.27
44 0.25
45 0.25
46 0.24
47 0.18
48 0.2
49 0.24
50 0.25
51 0.25
52 0.26
53 0.3
54 0.3
55 0.32
56 0.31
57 0.26
58 0.27
59 0.3
60 0.32
61 0.33
62 0.39
63 0.45
64 0.5
65 0.52
66 0.57
67 0.56
68 0.55
69 0.54
70 0.48
71 0.46
72 0.45
73 0.45
74 0.38
75 0.37
76 0.36
77 0.32
78 0.3
79 0.23
80 0.16
81 0.13
82 0.14
83 0.14
84 0.13
85 0.13
86 0.14
87 0.15
88 0.16
89 0.16
90 0.14
91 0.15
92 0.17
93 0.17
94 0.16
95 0.14
96 0.13
97 0.13
98 0.12
99 0.12
100 0.11
101 0.12
102 0.13
103 0.13
104 0.13
105 0.14
106 0.15
107 0.12
108 0.14
109 0.14
110 0.15
111 0.17
112 0.19
113 0.21
114 0.25
115 0.24
116 0.22
117 0.21
118 0.24
119 0.21
120 0.2
121 0.17
122 0.13
123 0.12
124 0.12
125 0.12
126 0.07
127 0.07
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.05
135 0.05
136 0.06
137 0.06
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.08
144 0.09
145 0.09
146 0.1
147 0.14
148 0.15
149 0.17
150 0.24
151 0.26
152 0.28
153 0.31
154 0.31
155 0.27
156 0.29
157 0.26
158 0.19
159 0.15
160 0.13
161 0.11
162 0.13
163 0.16
164 0.15
165 0.15
166 0.16
167 0.18
168 0.19
169 0.27
170 0.27
171 0.32
172 0.35
173 0.37
174 0.37
175 0.36
176 0.35
177 0.26
178 0.22
179 0.13
180 0.1
181 0.09
182 0.07
183 0.05
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.05
190 0.05
191 0.05
192 0.06
193 0.06
194 0.07
195 0.07
196 0.07
197 0.05
198 0.05
199 0.06
200 0.07
201 0.09
202 0.11
203 0.12
204 0.13
205 0.14
206 0.15
207 0.14
208 0.16
209 0.14
210 0.14
211 0.18
212 0.19
213 0.18
214 0.18
215 0.2
216 0.18
217 0.17
218 0.15
219 0.11
220 0.12
221 0.12
222 0.12
223 0.11
224 0.11
225 0.11
226 0.11
227 0.11
228 0.17
229 0.21
230 0.21
231 0.2
232 0.21
233 0.21
234 0.21
235 0.22
236 0.22
237 0.19
238 0.24
239 0.27
240 0.3
241 0.31
242 0.34
243 0.4
244 0.37
245 0.45
246 0.48
247 0.53
248 0.53
249 0.58
250 0.62
251 0.66
252 0.68
253 0.69
254 0.71
255 0.74
256 0.79
257 0.79
258 0.81
259 0.8
260 0.82
261 0.79
262 0.79
263 0.78
264 0.74
265 0.71
266 0.64
267 0.6
268 0.5
269 0.44
270 0.35
271 0.26
272 0.22
273 0.18
274 0.15
275 0.1
276 0.12
277 0.12
278 0.1
279 0.09
280 0.1
281 0.14
282 0.16
283 0.17
284 0.16
285 0.23
286 0.23
287 0.24
288 0.33
289 0.3
290 0.31
291 0.37
292 0.46
293 0.42
294 0.49
295 0.55
296 0.52
297 0.54
298 0.54
299 0.52
300 0.46
301 0.49
302 0.46
303 0.49
304 0.44
305 0.44
306 0.43
307 0.42
308 0.4
309 0.34
310 0.37
311 0.37
312 0.43
313 0.46
314 0.44
315 0.42
316 0.45
317 0.49
318 0.48
319 0.45
320 0.41
321 0.39
322 0.42
323 0.42
324 0.39
325 0.35
326 0.36
327 0.32
328 0.3
329 0.31