Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GD12

Protein Details
Accession A0A2T4GD12    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-33QKANLARIRDNQRRSRARRREYLQELEQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MSTPAQKANLARIRDNQRRSRARRREYLQELEQRLRVYELQGVEASSEVQHAARRVAEENRQLRGLLNRHGIGDDYISNYLNSGTATQADPTTMSSFASNTPSESVQSLQQVIAPRRPTTLETGVSYVIPPQDSREPSIASGSTSSSSLWEPGQSIQPGPAYAHTHNRPLPSNVSTPVPRHSITSSMHPSNTLRTCSLTPKSHGPKAIILSPHQDLWWMILVGIAILWHPCKQMSRHRWATLCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.68
4 0.72
5 0.78
6 0.83
7 0.85
8 0.86
9 0.86
10 0.87
11 0.84
12 0.84
13 0.81
14 0.8
15 0.77
16 0.75
17 0.72
18 0.65
19 0.62
20 0.52
21 0.45
22 0.39
23 0.31
24 0.24
25 0.23
26 0.2
27 0.19
28 0.19
29 0.18
30 0.15
31 0.14
32 0.13
33 0.09
34 0.08
35 0.07
36 0.07
37 0.09
38 0.1
39 0.12
40 0.12
41 0.14
42 0.17
43 0.21
44 0.27
45 0.34
46 0.37
47 0.37
48 0.37
49 0.35
50 0.34
51 0.36
52 0.34
53 0.31
54 0.32
55 0.3
56 0.29
57 0.29
58 0.28
59 0.21
60 0.19
61 0.14
62 0.11
63 0.11
64 0.11
65 0.11
66 0.1
67 0.1
68 0.08
69 0.08
70 0.06
71 0.06
72 0.07
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.09
79 0.1
80 0.09
81 0.09
82 0.08
83 0.09
84 0.1
85 0.13
86 0.11
87 0.1
88 0.12
89 0.12
90 0.12
91 0.12
92 0.12
93 0.1
94 0.11
95 0.11
96 0.1
97 0.12
98 0.15
99 0.16
100 0.2
101 0.2
102 0.19
103 0.2
104 0.21
105 0.2
106 0.2
107 0.22
108 0.2
109 0.18
110 0.19
111 0.18
112 0.17
113 0.16
114 0.12
115 0.09
116 0.08
117 0.07
118 0.09
119 0.13
120 0.15
121 0.17
122 0.18
123 0.18
124 0.18
125 0.2
126 0.17
127 0.12
128 0.12
129 0.1
130 0.09
131 0.09
132 0.08
133 0.08
134 0.08
135 0.09
136 0.08
137 0.08
138 0.08
139 0.09
140 0.13
141 0.13
142 0.13
143 0.13
144 0.13
145 0.14
146 0.13
147 0.15
148 0.16
149 0.17
150 0.25
151 0.26
152 0.31
153 0.33
154 0.35
155 0.35
156 0.34
157 0.36
158 0.31
159 0.32
160 0.28
161 0.3
162 0.3
163 0.29
164 0.3
165 0.29
166 0.26
167 0.26
168 0.25
169 0.26
170 0.25
171 0.31
172 0.34
173 0.33
174 0.33
175 0.33
176 0.32
177 0.35
178 0.37
179 0.32
180 0.26
181 0.27
182 0.29
183 0.34
184 0.41
185 0.37
186 0.37
187 0.45
188 0.51
189 0.53
190 0.54
191 0.5
192 0.47
193 0.47
194 0.49
195 0.41
196 0.36
197 0.36
198 0.34
199 0.32
200 0.27
201 0.24
202 0.19
203 0.19
204 0.2
205 0.15
206 0.13
207 0.12
208 0.12
209 0.11
210 0.1
211 0.08
212 0.05
213 0.06
214 0.08
215 0.09
216 0.1
217 0.13
218 0.18
219 0.24
220 0.35
221 0.43
222 0.52
223 0.6
224 0.66