Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GKB1

Protein Details
Accession A0A2T4GKB1    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
236-278DRDERRRSPSRSRSRSHSRSRSRSRSRSRSRSRSRSRSRSRSPBasic
NLS Segment(s)
PositionSequence
146-153RKLRRRGR
240-278RRRSPSRSRSRSHSRSRSRSRSRSRSRSRSRSRSRSRSP
Subcellular Location(s) nucl 16, cyto_nucl 15.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR005037  PRP38  
Gene Ontology GO:0071011  C:precatalytic spliceosome  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF03371  PRP38  
Amino Acid Sequences MSRDKDTVHADARRFLDERGSNVSVAPNGLNPATIMEKAVRDRIVDSIYYKMQCFACNEADIVDRVVEDVKFIGGTYGTTQVPSPFLCLAFKLLELSPSDAVLLEYLKFGGEAFKYLRALACFYFRLTRQAKNVYEMLEPFLEDRRKLRRRGREGVKLSYMDEFVDDLLTKERVCGTSLWKMPKREVLEDLEILEPRVSPLGDLEDLLEEEDEAEKENGTREESGEISEGDVMEVDRDERRRSPSRSRSRSHSRSRSRSRSRSRSRSRSRSRSRSRSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.38
4 0.35
5 0.36
6 0.37
7 0.37
8 0.32
9 0.32
10 0.33
11 0.24
12 0.23
13 0.2
14 0.13
15 0.14
16 0.13
17 0.13
18 0.11
19 0.12
20 0.13
21 0.13
22 0.13
23 0.13
24 0.17
25 0.19
26 0.23
27 0.22
28 0.21
29 0.22
30 0.23
31 0.23
32 0.21
33 0.21
34 0.2
35 0.24
36 0.25
37 0.24
38 0.25
39 0.24
40 0.25
41 0.26
42 0.26
43 0.24
44 0.23
45 0.23
46 0.2
47 0.2
48 0.19
49 0.16
50 0.12
51 0.09
52 0.09
53 0.1
54 0.08
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.05
62 0.06
63 0.07
64 0.1
65 0.1
66 0.1
67 0.11
68 0.11
69 0.13
70 0.12
71 0.13
72 0.11
73 0.12
74 0.12
75 0.12
76 0.13
77 0.12
78 0.12
79 0.11
80 0.1
81 0.12
82 0.12
83 0.14
84 0.12
85 0.12
86 0.11
87 0.09
88 0.09
89 0.08
90 0.07
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.08
100 0.09
101 0.11
102 0.11
103 0.12
104 0.13
105 0.12
106 0.13
107 0.12
108 0.13
109 0.12
110 0.13
111 0.15
112 0.14
113 0.22
114 0.23
115 0.26
116 0.27
117 0.34
118 0.34
119 0.34
120 0.35
121 0.29
122 0.27
123 0.24
124 0.21
125 0.14
126 0.13
127 0.1
128 0.14
129 0.13
130 0.12
131 0.16
132 0.25
133 0.31
134 0.39
135 0.46
136 0.52
137 0.59
138 0.69
139 0.74
140 0.73
141 0.72
142 0.69
143 0.63
144 0.54
145 0.46
146 0.37
147 0.29
148 0.19
149 0.14
150 0.1
151 0.07
152 0.07
153 0.06
154 0.06
155 0.07
156 0.08
157 0.07
158 0.08
159 0.09
160 0.09
161 0.11
162 0.11
163 0.14
164 0.21
165 0.26
166 0.34
167 0.38
168 0.39
169 0.4
170 0.46
171 0.46
172 0.41
173 0.39
174 0.36
175 0.33
176 0.32
177 0.31
178 0.26
179 0.22
180 0.19
181 0.16
182 0.11
183 0.09
184 0.09
185 0.08
186 0.06
187 0.07
188 0.09
189 0.09
190 0.09
191 0.1
192 0.09
193 0.09
194 0.1
195 0.09
196 0.05
197 0.06
198 0.06
199 0.06
200 0.07
201 0.08
202 0.07
203 0.08
204 0.11
205 0.12
206 0.13
207 0.14
208 0.13
209 0.15
210 0.15
211 0.16
212 0.15
213 0.13
214 0.12
215 0.12
216 0.11
217 0.08
218 0.08
219 0.07
220 0.06
221 0.06
222 0.08
223 0.11
224 0.14
225 0.19
226 0.22
227 0.3
228 0.38
229 0.45
230 0.55
231 0.61
232 0.7
233 0.75
234 0.77
235 0.79
236 0.81
237 0.85
238 0.85
239 0.85
240 0.84
241 0.86
242 0.91
243 0.92
244 0.92
245 0.93
246 0.93
247 0.93
248 0.93
249 0.94
250 0.94
251 0.94
252 0.94
253 0.95
254 0.95
255 0.95
256 0.95
257 0.95
258 0.95