Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4H9T9

Protein Details
Accession A0A2T4H9T9    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-25VNYTPRTHPEHKNKEHCRVHSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
Amino Acid Sequences MLSFVNYTPRTHPEHKNKEHCRVHSDPANIPHDVSQKTPVAEPKSSVPRSAAPPAPTTQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.7
3 0.77
4 0.79
5 0.83
6 0.83
7 0.76
8 0.73
9 0.66
10 0.62
11 0.57
12 0.53
13 0.46
14 0.45
15 0.44
16 0.36
17 0.32
18 0.29
19 0.27
20 0.25
21 0.22
22 0.2
23 0.19
24 0.2
25 0.22
26 0.25
27 0.26
28 0.26
29 0.26
30 0.29
31 0.37
32 0.38
33 0.37
34 0.34
35 0.34
36 0.38
37 0.44
38 0.42
39 0.35
40 0.38