Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4H0J8

Protein Details
Accession A0A2T4H0J8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-65VPTRKRRAIAEQQKQQQQQKKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 6, extr 6, E.R. 3, cyto 2, pero 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MKFQLFTIIALVSVASAGLIKRVDVEVPAMTDAQGNIVVFNAAEVPTRKRRAIAEQQKQQQQQKKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.03
3 0.03
4 0.03
5 0.06
6 0.06
7 0.06
8 0.07
9 0.08
10 0.08
11 0.08
12 0.1
13 0.08
14 0.08
15 0.09
16 0.08
17 0.08
18 0.08
19 0.07
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.06
31 0.08
32 0.13
33 0.22
34 0.26
35 0.27
36 0.29
37 0.32
38 0.4
39 0.5
40 0.55
41 0.58
42 0.63
43 0.71
44 0.77
45 0.82
46 0.82
47 0.8