Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GSX0

Protein Details
Accession A0A2T4GSX0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
341-367LSPIKMLEPKPERRPERKPPGPAWKDYHydrophilic
NLS Segment(s)
PositionSequence
350-360KPERRPERKPP
Subcellular Location(s) plas 21, mito 2, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTLTKAFPPPKGQTVIGVSFTLIAFAAAIIGFRIYHRLRIQKGRLVLSDYFMILALCGAITCASFDVVFWQRDVLRPRMSVGFENYNPGEELVEFIYKNPQLSWASEIPFYATVYLCKAILLALYFQIFPPFMGRRRRALWATVFYCGLAYTITLCMQLFSCMPLERHWVISRPITACDWRWQGVVFQVSWALAFLGSLLVLILPFMVVHDFDLIKRSKFCLYFVSLVGVLDIGISLIRFLNVELGDGTEFRSFSTIEFWSALDVNIGLITACLPALRILLGRTRTPDTYTFDEAKTARSSRAMEHRELEEVEGSTYLGISNTAGPSRSNRASTYSDKGSLSPIKMLEPKPERRPERKPPGPAWKDYEGEDSDLELENINVEALNRDQAQSYWSVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.4
4 0.35
5 0.28
6 0.24
7 0.23
8 0.18
9 0.12
10 0.08
11 0.06
12 0.06
13 0.06
14 0.04
15 0.05
16 0.04
17 0.05
18 0.05
19 0.06
20 0.14
21 0.14
22 0.22
23 0.29
24 0.37
25 0.44
26 0.54
27 0.61
28 0.59
29 0.64
30 0.62
31 0.58
32 0.55
33 0.48
34 0.41
35 0.35
36 0.29
37 0.23
38 0.18
39 0.15
40 0.1
41 0.09
42 0.06
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.12
54 0.17
55 0.17
56 0.17
57 0.19
58 0.2
59 0.26
60 0.31
61 0.31
62 0.3
63 0.3
64 0.33
65 0.35
66 0.36
67 0.33
68 0.34
69 0.35
70 0.3
71 0.35
72 0.33
73 0.29
74 0.27
75 0.24
76 0.2
77 0.12
78 0.13
79 0.1
80 0.12
81 0.1
82 0.1
83 0.17
84 0.17
85 0.18
86 0.16
87 0.2
88 0.19
89 0.21
90 0.26
91 0.23
92 0.23
93 0.23
94 0.23
95 0.2
96 0.19
97 0.18
98 0.14
99 0.11
100 0.1
101 0.12
102 0.12
103 0.1
104 0.09
105 0.09
106 0.08
107 0.08
108 0.08
109 0.06
110 0.07
111 0.08
112 0.08
113 0.08
114 0.09
115 0.08
116 0.08
117 0.12
118 0.14
119 0.2
120 0.29
121 0.32
122 0.36
123 0.39
124 0.45
125 0.43
126 0.44
127 0.43
128 0.41
129 0.39
130 0.36
131 0.33
132 0.27
133 0.25
134 0.2
135 0.15
136 0.07
137 0.05
138 0.05
139 0.06
140 0.06
141 0.07
142 0.06
143 0.07
144 0.07
145 0.08
146 0.07
147 0.07
148 0.08
149 0.09
150 0.1
151 0.11
152 0.16
153 0.16
154 0.19
155 0.19
156 0.2
157 0.21
158 0.23
159 0.25
160 0.2
161 0.21
162 0.2
163 0.21
164 0.2
165 0.23
166 0.23
167 0.21
168 0.2
169 0.19
170 0.18
171 0.19
172 0.19
173 0.13
174 0.11
175 0.1
176 0.09
177 0.09
178 0.08
179 0.05
180 0.03
181 0.03
182 0.03
183 0.03
184 0.02
185 0.02
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.03
196 0.03
197 0.04
198 0.05
199 0.05
200 0.1
201 0.11
202 0.12
203 0.13
204 0.14
205 0.17
206 0.18
207 0.19
208 0.18
209 0.21
210 0.22
211 0.21
212 0.21
213 0.17
214 0.16
215 0.15
216 0.11
217 0.07
218 0.05
219 0.04
220 0.03
221 0.02
222 0.02
223 0.03
224 0.03
225 0.03
226 0.03
227 0.04
228 0.07
229 0.07
230 0.07
231 0.07
232 0.08
233 0.08
234 0.08
235 0.1
236 0.08
237 0.08
238 0.07
239 0.09
240 0.08
241 0.08
242 0.12
243 0.11
244 0.11
245 0.12
246 0.11
247 0.12
248 0.12
249 0.11
250 0.08
251 0.07
252 0.06
253 0.05
254 0.05
255 0.04
256 0.03
257 0.04
258 0.03
259 0.03
260 0.03
261 0.04
262 0.04
263 0.05
264 0.05
265 0.06
266 0.07
267 0.12
268 0.15
269 0.16
270 0.2
271 0.23
272 0.24
273 0.26
274 0.29
275 0.29
276 0.32
277 0.35
278 0.34
279 0.31
280 0.34
281 0.31
282 0.31
283 0.3
284 0.26
285 0.23
286 0.24
287 0.25
288 0.27
289 0.37
290 0.37
291 0.36
292 0.38
293 0.38
294 0.37
295 0.36
296 0.31
297 0.23
298 0.19
299 0.16
300 0.13
301 0.12
302 0.09
303 0.08
304 0.07
305 0.05
306 0.05
307 0.05
308 0.07
309 0.09
310 0.1
311 0.11
312 0.12
313 0.16
314 0.23
315 0.27
316 0.27
317 0.27
318 0.31
319 0.36
320 0.41
321 0.43
322 0.4
323 0.4
324 0.38
325 0.38
326 0.39
327 0.38
328 0.35
329 0.32
330 0.28
331 0.29
332 0.36
333 0.37
334 0.4
335 0.44
336 0.51
337 0.57
338 0.66
339 0.7
340 0.73
341 0.81
342 0.82
343 0.84
344 0.85
345 0.84
346 0.83
347 0.85
348 0.83
349 0.79
350 0.75
351 0.69
352 0.62
353 0.56
354 0.52
355 0.43
356 0.39
357 0.32
358 0.26
359 0.22
360 0.21
361 0.19
362 0.13
363 0.11
364 0.09
365 0.09
366 0.08
367 0.07
368 0.06
369 0.09
370 0.1
371 0.14
372 0.15
373 0.16
374 0.17
375 0.17
376 0.19