Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GW57

Protein Details
Accession A0A2T4GW57   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVSAKKHVPIVKKRTKRFERHQHDRFMRVSPSWRKPKGIDSRVRRRFRGBasic
NLS Segment(s)
PositionSequence
6-47KHVPIVKKRTKRFERHQHDRFMRVSPSWRKPKGIDSRVRRRF
Subcellular Location(s) mito 18.5, mito_nucl 11.333, cyto 5.5, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKRFERHQHDRFMRVSPSWRKPKGIDSRVRRRFRGTIAMPSIGYGSNKKTRYMAPSGFKAFIVSNKSDLELLLMHNKTHAAEIAHNVSSRKRVDIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.88
4 0.89
5 0.89
6 0.89
7 0.9
8 0.88
9 0.88
10 0.83
11 0.78
12 0.69
13 0.62
14 0.54
15 0.46
16 0.48
17 0.46
18 0.51
19 0.56
20 0.57
21 0.56
22 0.55
23 0.63
24 0.64
25 0.64
26 0.64
27 0.64
28 0.72
29 0.78
30 0.81
31 0.73
32 0.68
33 0.62
34 0.57
35 0.56
36 0.48
37 0.46
38 0.43
39 0.42
40 0.36
41 0.32
42 0.29
43 0.2
44 0.18
45 0.12
46 0.13
47 0.19
48 0.2
49 0.21
50 0.22
51 0.23
52 0.27
53 0.31
54 0.33
55 0.29
56 0.32
57 0.34
58 0.33
59 0.3
60 0.27
61 0.22
62 0.2
63 0.2
64 0.17
65 0.17
66 0.16
67 0.17
68 0.16
69 0.15
70 0.13
71 0.09
72 0.1
73 0.14
74 0.15
75 0.14
76 0.14
77 0.15
78 0.14
79 0.14
80 0.15
81 0.09
82 0.11
83 0.14
84 0.18
85 0.19
86 0.2
87 0.2
88 0.2
89 0.24
90 0.24
91 0.23
92 0.21
93 0.23
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.33
105 0.3
106 0.35
107 0.43
108 0.5
109 0.49
110 0.5
111 0.47