FuNGI

A0A2T4GRS2

Protein Details

Accession

A0A2T4GRS2

Localization Confidence

Low

Confidence Score

9.4

NoLS Segment(s)

Position	Sequence	Protein Nature
24-43	GPVSRRVRCGKPRTPTLEEM	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 16.5, cyto_nucl 11.5, cyto 5.5, pero 4

Family & Domain DBs

InterPro	View protein in InterPro IPR026992 DIOX_N IPR044861 IPNS-like_FE2OG_OXY IPR027443 IPNS-like_sf IPR005123 Oxoglu/Fe-dep_dioxygenase IPR011051 RmlC_Cupin_sf
Gene Ontology	GO:1901362 P:organic cyclic compound biosynthetic process GO:0044283 P:small molecule biosynthetic process
Pfam	View protein in Pfam PF03171 2OG-FeII_Oxy PF14226 DIOX_N
PROSITE	View protein in PROSITE PS51471 FE2OG_OXY
CDD	cd02208 cupin_RmlC-like

Amino Acid Sequences

MATTTVQTTAPAEYTTVQLLTPNGPVSRRVRCGKPRTPTLEEMPVIDLSSIDGDESARKALSTQIKAAAENTGFFYVSNHGIPQDLIEEALQQCKNFFDQSQDDKDRVAFTKAGKFCGYHGVGSTQINNKETKDNKETFSMRYDTRIDPSHDCVDDINSNFDSIDFVWNGTSHLTKFRPVLTEFYQRRLTLARKLIRLFALALELPEDYFDSIITTPGADAVHLHYPGTEETDDIDVGIGSHTDIQCVTLLWQDMSGGLQVLSADDEWLDARPIEGTLVINIGDFLQRLSNNRFKSTVHRVYNRQKTSRYAMPFFLGFNPDAVCEVVPTCTDAEHSPLYEPISCGESAQPPRTNNARNNPITYDSGRSSVKFGKPNSDYIMTHRIPPTTKEHGTSIVAPPFHYHIHQDEFFNVQSGMGRFYRGIAKEPFAVLSDKPGGQRKASIKAGRYHRFENASETEDLVVDIHLAPESYENEQRFFRNFFGYLDDCREVGKPPSFFQLMVFLHDGDTPLAVPMPWEWLGKIASRLLLWSAAFWGRFILGYKVTYPEYYEETKSR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.15
2	0.16
3	0.15
4	0.13
5	0.14
6	0.15
7	0.16
8	0.17
9	0.19
10	0.19
11	0.2
12	0.27
13	0.31
14	0.38
15	0.44
16	0.48
17	0.55
18	0.63
19	0.72
20	0.75
21	0.78
22	0.8
23	0.8
24	0.8
25	0.76
26	0.72
27	0.7
28	0.61
29	0.53
30	0.46
31	0.38
32	0.31
33	0.25
34	0.19
35	0.11
36	0.11
37	0.09
38	0.07
39	0.07
40	0.07
41	0.09
42	0.11
43	0.11
44	0.1
45	0.1
46	0.11
47	0.18
48	0.27
49	0.28
50	0.3
51	0.35
52	0.37
53	0.37
54	0.38
55	0.35
56	0.27
57	0.24
58	0.24
59	0.18
60	0.17
61	0.16
62	0.17
63	0.15
64	0.17
65	0.16
66	0.14
67	0.13
68	0.14
69	0.14
70	0.13
71	0.11
72	0.09
73	0.09
74	0.08
75	0.11
76	0.11
77	0.18
78	0.18
79	0.17
80	0.17
81	0.18
82	0.2
83	0.19
84	0.19
85	0.2
86	0.26
87	0.32
88	0.41
89	0.43
90	0.41
91	0.4
92	0.41
93	0.38
94	0.33
95	0.29
96	0.23
97	0.23
98	0.32
99	0.33
100	0.35
101	0.33
102	0.31
103	0.29
104	0.35
105	0.33
106	0.24
107	0.24
108	0.22
109	0.23
110	0.24
111	0.27
112	0.24
113	0.26
114	0.27
115	0.27
116	0.27
117	0.34
118	0.37
119	0.4
120	0.42
121	0.42
122	0.43
123	0.49
124	0.49
125	0.43
126	0.44
127	0.4
128	0.32
129	0.33
130	0.35
131	0.3
132	0.31
133	0.33
134	0.32
135	0.32
136	0.36
137	0.36
138	0.32
139	0.31
140	0.27
141	0.26
142	0.26
143	0.24
144	0.22
145	0.17
146	0.17
147	0.17
148	0.16
149	0.14
150	0.11
151	0.13
152	0.09
153	0.1
154	0.1
155	0.1
156	0.11
157	0.11
158	0.11
159	0.09
160	0.15
161	0.16
162	0.18
163	0.19
164	0.21
165	0.24
166	0.24
167	0.29
168	0.28
169	0.38
170	0.36
171	0.4
172	0.42
173	0.38
174	0.37
175	0.37
176	0.35
177	0.32
178	0.39
179	0.39
180	0.4
181	0.41
182	0.42
183	0.38
184	0.36
185	0.29
186	0.2
187	0.17
188	0.13
189	0.11
190	0.09
191	0.08
192	0.07
193	0.07
194	0.07
195	0.05
196	0.05
197	0.05
198	0.05
199	0.05
200	0.06
201	0.06
202	0.05
203	0.05
204	0.06
205	0.06
206	0.05
207	0.05
208	0.07
209	0.1
210	0.1
211	0.1
212	0.09
213	0.1
214	0.11
215	0.13
216	0.1
217	0.08
218	0.09
219	0.1
220	0.09
221	0.08
222	0.08
223	0.05
224	0.05
225	0.05
226	0.04
227	0.03
228	0.06
229	0.06
230	0.06
231	0.06
232	0.07
233	0.07
234	0.07
235	0.08
236	0.07
237	0.07
238	0.07
239	0.07
240	0.06
241	0.06
242	0.06
243	0.06
244	0.04
245	0.03
246	0.04
247	0.03
248	0.04
249	0.04
250	0.04
251	0.03
252	0.03
253	0.04
254	0.04
255	0.04
256	0.04
257	0.04
258	0.04
259	0.04
260	0.04
261	0.04
262	0.05
263	0.04
264	0.04
265	0.05
266	0.05
267	0.04
268	0.04
269	0.04
270	0.04
271	0.04
272	0.04
273	0.06
274	0.06
275	0.1
276	0.15
277	0.21
278	0.22
279	0.24
280	0.25
281	0.24
282	0.31
283	0.38
284	0.42
285	0.42
286	0.46
287	0.52
288	0.61
289	0.7
290	0.68
291	0.63
292	0.56
293	0.54
294	0.55
295	0.53
296	0.48
297	0.41
298	0.36
299	0.33
300	0.31
301	0.28
302	0.23
303	0.18
304	0.13
305	0.11
306	0.1
307	0.09
308	0.09
309	0.09
310	0.07
311	0.06
312	0.06
313	0.06
314	0.06
315	0.07
316	0.06
317	0.06
318	0.07
319	0.07
320	0.1
321	0.1
322	0.11
323	0.1
324	0.11
325	0.13
326	0.12
327	0.12
328	0.1
329	0.11
330	0.11
331	0.1
332	0.11
333	0.16
334	0.19
335	0.25
336	0.28
337	0.27
338	0.31
339	0.37
340	0.42
341	0.43
342	0.48
343	0.51
344	0.49
345	0.51
346	0.49
347	0.46
348	0.42
349	0.37
350	0.33
351	0.25
352	0.26
353	0.24
354	0.23
355	0.23
356	0.27
357	0.3
358	0.32
359	0.32
360	0.38
361	0.39
362	0.42
363	0.42
364	0.39
365	0.35
366	0.33
367	0.41
368	0.33
369	0.35
370	0.34
371	0.32
372	0.29
373	0.32
374	0.34
375	0.33
376	0.35
377	0.33
378	0.32
379	0.33
380	0.34
381	0.33
382	0.3
383	0.26
384	0.25
385	0.22
386	0.22
387	0.22
388	0.21
389	0.19
390	0.17
391	0.18
392	0.23
393	0.25
394	0.24
395	0.23
396	0.25
397	0.24
398	0.22
399	0.18
400	0.13
401	0.14
402	0.13
403	0.16
404	0.13
405	0.14
406	0.13
407	0.15
408	0.2
409	0.19
410	0.23
411	0.23
412	0.25
413	0.25
414	0.26
415	0.25
416	0.2
417	0.21
418	0.16
419	0.18
420	0.19
421	0.19
422	0.23
423	0.3
424	0.3
425	0.3
426	0.37
427	0.37
428	0.42
429	0.48
430	0.49
431	0.47
432	0.53
433	0.62
434	0.63
435	0.63
436	0.59
437	0.56
438	0.56
439	0.52
440	0.5
441	0.44
442	0.39
443	0.35
444	0.32
445	0.27
446	0.22
447	0.21
448	0.14
449	0.1
450	0.07
451	0.07
452	0.06
453	0.06
454	0.06
455	0.06
456	0.08
457	0.11
458	0.14
459	0.2
460	0.21
461	0.23
462	0.25
463	0.28
464	0.29
465	0.3
466	0.28
467	0.27
468	0.27
469	0.25
470	0.29
471	0.29
472	0.28
473	0.32
474	0.31
475	0.26
476	0.26
477	0.26
478	0.23
479	0.27
480	0.31
481	0.27
482	0.28
483	0.34
484	0.34
485	0.33
486	0.31
487	0.33
488	0.27
489	0.29
490	0.29
491	0.23
492	0.22
493	0.22
494	0.22
495	0.14
496	0.14
497	0.1
498	0.09
499	0.09
500	0.08
501	0.08
502	0.07
503	0.12
504	0.14
505	0.14
506	0.14
507	0.17
508	0.19
509	0.21
510	0.23
511	0.2
512	0.2
513	0.19
514	0.2
515	0.19
516	0.2
517	0.17
518	0.15
519	0.17
520	0.18
521	0.18
522	0.17
523	0.17
524	0.14
525	0.15
526	0.17
527	0.17
528	0.17
529	0.19
530	0.2
531	0.23
532	0.25
533	0.24
534	0.25
535	0.24
536	0.26
537	0.29

A0A2T4GRS2

3D AlphaFold-predicted Structure Viewer