Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4H9L8

Protein Details
Accession A0A2T4H9L8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
27-50NKYDKHGYSKKYKKQRKYDHMGSABasic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MCLPFFRKKKQPMVYDYYPQPAMGYSNKYDKHGYSKKYKKQRKYDHMGSAVGNAAGIWADGWGGSGGDGGGGGSGGCDGGGGGGGGGAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.71
3 0.65
4 0.59
5 0.5
6 0.42
7 0.34
8 0.26
9 0.23
10 0.19
11 0.2
12 0.18
13 0.25
14 0.27
15 0.29
16 0.31
17 0.29
18 0.36
19 0.39
20 0.41
21 0.45
22 0.54
23 0.6
24 0.69
25 0.76
26 0.76
27 0.8
28 0.86
29 0.85
30 0.84
31 0.83
32 0.79
33 0.73
34 0.65
35 0.54
36 0.44
37 0.34
38 0.24
39 0.16
40 0.09
41 0.06
42 0.04
43 0.04
44 0.03
45 0.02
46 0.02
47 0.02
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.02
60 0.02
61 0.03
62 0.03
63 0.02
64 0.03
65 0.02
66 0.03
67 0.03
68 0.03
69 0.03