Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GKH8

Protein Details
Accession A0A2T4GKH8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
117-144CYEPVRKLYCKIDRKRRRRGFEHSTQSQHydrophilic
NLS Segment(s)
PositionSequence
131-134KRRR
Subcellular Location(s) cyto_nucl 8cysk 8, nucl 7.5, cyto 7.5, mito 2
Family & Domain DBs
Amino Acid Sequences MNGLDAPQRHFITLCIVIEAFITYVGEASFTPSEAAWHRSRPNEMREEVQPRSRQVDAGPPEPSPKIDTPFEKGSRACRRTGSAMRDPLSVIRHSRFHSHGGAALTTGGCYNSVDVCYEPVRKLYCKIDRKRRRRGFEHSTQSQISLGLFIHKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.19
4 0.18
5 0.18
6 0.17
7 0.11
8 0.07
9 0.07
10 0.05
11 0.05
12 0.05
13 0.06
14 0.05
15 0.09
16 0.09
17 0.09
18 0.1
19 0.09
20 0.12
21 0.14
22 0.19
23 0.18
24 0.23
25 0.27
26 0.3
27 0.37
28 0.4
29 0.44
30 0.45
31 0.44
32 0.43
33 0.45
34 0.47
35 0.44
36 0.45
37 0.42
38 0.38
39 0.4
40 0.36
41 0.31
42 0.26
43 0.31
44 0.28
45 0.28
46 0.27
47 0.24
48 0.25
49 0.25
50 0.25
51 0.2
52 0.18
53 0.18
54 0.2
55 0.21
56 0.24
57 0.3
58 0.31
59 0.29
60 0.29
61 0.34
62 0.41
63 0.41
64 0.38
65 0.33
66 0.34
67 0.38
68 0.43
69 0.41
70 0.37
71 0.4
72 0.4
73 0.39
74 0.36
75 0.32
76 0.29
77 0.24
78 0.2
79 0.18
80 0.2
81 0.21
82 0.25
83 0.25
84 0.26
85 0.26
86 0.24
87 0.25
88 0.23
89 0.21
90 0.17
91 0.15
92 0.12
93 0.1
94 0.09
95 0.06
96 0.05
97 0.06
98 0.06
99 0.06
100 0.07
101 0.08
102 0.08
103 0.11
104 0.13
105 0.16
106 0.16
107 0.19
108 0.22
109 0.23
110 0.28
111 0.35
112 0.42
113 0.5
114 0.59
115 0.66
116 0.74
117 0.82
118 0.89
119 0.9
120 0.9
121 0.87
122 0.87
123 0.85
124 0.85
125 0.85
126 0.79
127 0.74
128 0.65
129 0.58
130 0.49
131 0.4
132 0.29
133 0.21
134 0.16