Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4HB51

Protein Details
Accession A0A2T4HB51    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-29PKAAAPAKRATRTKRAKKDPNAPKRGLSHydrophilic
NLS Segment(s)
PositionSequence
6-26APAKRATRTKRAKKDPNAPKR
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAAAPAKRATRTKRAKKDPNAPKRGLSAYMFFANEQRENVREENPGISFGQVGKLLGERWKALNEKQRAPYEAKAAADKKRYEDEKQAYNADQEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.83
4 0.85
5 0.87
6 0.91
7 0.91
8 0.91
9 0.89
10 0.81
11 0.72
12 0.66
13 0.59
14 0.52
15 0.42
16 0.34
17 0.28
18 0.27
19 0.25
20 0.21
21 0.21
22 0.2
23 0.19
24 0.17
25 0.16
26 0.15
27 0.18
28 0.19
29 0.18
30 0.17
31 0.17
32 0.17
33 0.16
34 0.16
35 0.13
36 0.12
37 0.1
38 0.08
39 0.09
40 0.07
41 0.07
42 0.06
43 0.07
44 0.07
45 0.1
46 0.11
47 0.1
48 0.12
49 0.15
50 0.17
51 0.22
52 0.3
53 0.33
54 0.39
55 0.44
56 0.47
57 0.46
58 0.49
59 0.46
60 0.42
61 0.4
62 0.35
63 0.35
64 0.35
65 0.38
66 0.41
67 0.4
68 0.39
69 0.44
70 0.47
71 0.46
72 0.52
73 0.52
74 0.52
75 0.55
76 0.55
77 0.48
78 0.46
79 0.42
80 0.34
81 0.28