Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4GPJ3

Protein Details
Accession A0A2T4GPJ3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-73CGYCGSKGGRTKRRTRSHMRSTRVHydrophilic
NLS Segment(s)
PositionSequence
60-63TKRR
Subcellular Location(s) plas 10, extr 6, vacu 5, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGGVMSCIRSCLQTIGDAIMAVIGGIGRILQAIIGAVVRFCGIIVSFLTCGYCGSKGGRTKRRTRSHMRSTRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.13
5 0.11
6 0.09
7 0.08
8 0.05
9 0.04
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.05
32 0.06
33 0.06
34 0.06
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.09
41 0.11
42 0.17
43 0.25
44 0.35
45 0.44
46 0.51
47 0.6
48 0.7
49 0.78
50 0.8
51 0.84
52 0.84
53 0.86