Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4GLZ6

Protein Details
Accession A0A2T4GLZ6    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-52PDGPWRRKVTKVKKELIHKAKVBasic
169-191DRDRYKKAMAKTRDRNGNKKLGRBasic
NLS Segment(s)
PositionSequence
31-61PDGPWRRKVTKVKKELIHKAKVKKAYAKIKA
160-192REEREQKMADRDRYKKAMAKTRDRNGNKKLGRE
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MAAKHQNEGADTASEVKKPKHGFRVGPENLPDGPWRRKVTKVKKELIHKAKVKKAYAKIKAREQENAQPAKTSEPVQDETPVEGAGEDKQPEEEGEKMHPTRHLMLADEAKAQENSVGEPSSDGNRRRTRRPGYYEKQLGKAAQLRQEQEARQAEFQRRREEREQKMADRDRYKKAMAKTRDRNGNKKLGRESSLLLDKVRKMVAEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.3
5 0.35
6 0.43
7 0.47
8 0.53
9 0.55
10 0.6
11 0.69
12 0.64
13 0.64
14 0.58
15 0.51
16 0.44
17 0.4
18 0.36
19 0.32
20 0.34
21 0.37
22 0.4
23 0.4
24 0.49
25 0.59
26 0.66
27 0.7
28 0.73
29 0.74
30 0.76
31 0.82
32 0.83
33 0.81
34 0.79
35 0.76
36 0.75
37 0.74
38 0.74
39 0.7
40 0.67
41 0.68
42 0.68
43 0.71
44 0.72
45 0.71
46 0.72
47 0.73
48 0.67
49 0.63
50 0.58
51 0.57
52 0.55
53 0.53
54 0.44
55 0.4
56 0.38
57 0.35
58 0.32
59 0.25
60 0.2
61 0.2
62 0.22
63 0.21
64 0.24
65 0.21
66 0.2
67 0.19
68 0.15
69 0.11
70 0.09
71 0.09
72 0.07
73 0.08
74 0.08
75 0.07
76 0.08
77 0.08
78 0.08
79 0.09
80 0.09
81 0.08
82 0.1
83 0.14
84 0.14
85 0.15
86 0.16
87 0.17
88 0.17
89 0.19
90 0.17
91 0.14
92 0.16
93 0.17
94 0.16
95 0.15
96 0.14
97 0.12
98 0.12
99 0.11
100 0.09
101 0.08
102 0.08
103 0.08
104 0.08
105 0.07
106 0.08
107 0.09
108 0.12
109 0.17
110 0.19
111 0.26
112 0.35
113 0.39
114 0.45
115 0.53
116 0.57
117 0.61
118 0.67
119 0.69
120 0.67
121 0.73
122 0.75
123 0.69
124 0.65
125 0.58
126 0.5
127 0.43
128 0.43
129 0.36
130 0.35
131 0.36
132 0.34
133 0.35
134 0.39
135 0.35
136 0.38
137 0.39
138 0.34
139 0.34
140 0.38
141 0.43
142 0.47
143 0.52
144 0.54
145 0.52
146 0.58
147 0.63
148 0.68
149 0.67
150 0.69
151 0.71
152 0.66
153 0.73
154 0.73
155 0.72
156 0.71
157 0.69
158 0.66
159 0.64
160 0.63
161 0.59
162 0.59
163 0.6
164 0.6
165 0.66
166 0.68
167 0.73
168 0.79
169 0.81
170 0.81
171 0.79
172 0.8
173 0.74
174 0.72
175 0.71
176 0.67
177 0.64
178 0.58
179 0.53
180 0.5
181 0.52
182 0.46
183 0.4
184 0.39
185 0.36
186 0.37
187 0.36
188 0.3