Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GK65

Protein Details
Accession A0A2T4GK65    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
118-148VELLQDKAKPKPKTRRQRKARHPWERQGEDQBasic
358-381QAPDSTPKRRRLPDAPVRRQHDEQHydrophilic
NLS Segment(s)
PositionSequence
124-140KAKPKPKTRRQRKARHP
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MGGKTWSRDEERLFWEVIVPQSAAAAYPDDDGCLSWEQLADEMNKLSGANARRVYTGTMLYEHHYQNIKPDHRSPKAAEFVDKYLQDAAYFKEHGSRRPSTPSNESASASEPLDPQIVELLQDKAKPKPKTRRQRKARHPWERQGEDQASRPFFSMPKTLEEIGAYSVTPGNRAQQQPPKGYTTPDRADIRSRSYPFPKSALVSVPGSGSVSVWNQPIGRSEIDGSQMSGRPAMAFERTPKLSSGFLKQPADEKMEGGYWHSTYRAGQDQRPKEAMYMTSGSTSAQSPQPQMDYASSWADLGPSHQRTHQEQWDGRLPSIREMLPHEFGTPAYDSYYPHEVNRRVDKRNFSNEQGHMQAPDSTPKRRRLPDAPVRRQHDEQQQPHRYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.31
4 0.29
5 0.24
6 0.19
7 0.16
8 0.16
9 0.16
10 0.13
11 0.11
12 0.1
13 0.09
14 0.11
15 0.11
16 0.11
17 0.11
18 0.11
19 0.13
20 0.14
21 0.13
22 0.12
23 0.12
24 0.12
25 0.13
26 0.15
27 0.14
28 0.14
29 0.14
30 0.13
31 0.13
32 0.12
33 0.12
34 0.15
35 0.17
36 0.23
37 0.26
38 0.27
39 0.28
40 0.29
41 0.31
42 0.28
43 0.28
44 0.22
45 0.2
46 0.2
47 0.22
48 0.27
49 0.25
50 0.28
51 0.28
52 0.26
53 0.32
54 0.41
55 0.43
56 0.42
57 0.5
58 0.55
59 0.57
60 0.63
61 0.59
62 0.57
63 0.6
64 0.57
65 0.53
66 0.46
67 0.45
68 0.45
69 0.4
70 0.33
71 0.28
72 0.26
73 0.22
74 0.19
75 0.18
76 0.16
77 0.17
78 0.16
79 0.22
80 0.23
81 0.28
82 0.34
83 0.36
84 0.35
85 0.43
86 0.47
87 0.46
88 0.5
89 0.49
90 0.48
91 0.46
92 0.44
93 0.37
94 0.35
95 0.31
96 0.25
97 0.21
98 0.16
99 0.15
100 0.15
101 0.13
102 0.11
103 0.1
104 0.09
105 0.09
106 0.1
107 0.11
108 0.12
109 0.15
110 0.17
111 0.23
112 0.31
113 0.37
114 0.45
115 0.53
116 0.63
117 0.71
118 0.81
119 0.85
120 0.87
121 0.92
122 0.94
123 0.94
124 0.95
125 0.94
126 0.92
127 0.9
128 0.89
129 0.83
130 0.74
131 0.7
132 0.62
133 0.53
134 0.49
135 0.45
136 0.36
137 0.32
138 0.3
139 0.24
140 0.21
141 0.22
142 0.21
143 0.18
144 0.19
145 0.22
146 0.22
147 0.21
148 0.2
149 0.18
150 0.14
151 0.13
152 0.1
153 0.07
154 0.09
155 0.08
156 0.09
157 0.09
158 0.11
159 0.16
160 0.18
161 0.23
162 0.29
163 0.35
164 0.38
165 0.4
166 0.42
167 0.37
168 0.38
169 0.37
170 0.37
171 0.33
172 0.35
173 0.34
174 0.31
175 0.35
176 0.34
177 0.36
178 0.35
179 0.36
180 0.34
181 0.36
182 0.38
183 0.35
184 0.36
185 0.31
186 0.26
187 0.25
188 0.22
189 0.19
190 0.16
191 0.15
192 0.12
193 0.11
194 0.1
195 0.09
196 0.07
197 0.06
198 0.06
199 0.08
200 0.08
201 0.09
202 0.09
203 0.1
204 0.12
205 0.13
206 0.12
207 0.12
208 0.12
209 0.12
210 0.15
211 0.14
212 0.13
213 0.13
214 0.14
215 0.13
216 0.12
217 0.11
218 0.09
219 0.09
220 0.1
221 0.1
222 0.09
223 0.12
224 0.17
225 0.19
226 0.2
227 0.2
228 0.21
229 0.22
230 0.23
231 0.25
232 0.26
233 0.31
234 0.31
235 0.3
236 0.32
237 0.32
238 0.34
239 0.28
240 0.23
241 0.18
242 0.18
243 0.18
244 0.16
245 0.15
246 0.12
247 0.12
248 0.12
249 0.12
250 0.11
251 0.15
252 0.21
253 0.23
254 0.27
255 0.36
256 0.41
257 0.45
258 0.47
259 0.43
260 0.36
261 0.35
262 0.31
263 0.26
264 0.23
265 0.18
266 0.16
267 0.16
268 0.15
269 0.14
270 0.14
271 0.12
272 0.14
273 0.16
274 0.16
275 0.18
276 0.2
277 0.19
278 0.2
279 0.19
280 0.17
281 0.17
282 0.17
283 0.16
284 0.14
285 0.13
286 0.12
287 0.11
288 0.12
289 0.19
290 0.2
291 0.21
292 0.24
293 0.3
294 0.35
295 0.43
296 0.47
297 0.47
298 0.46
299 0.51
300 0.56
301 0.53
302 0.48
303 0.46
304 0.4
305 0.35
306 0.37
307 0.32
308 0.25
309 0.29
310 0.33
311 0.31
312 0.31
313 0.27
314 0.24
315 0.23
316 0.24
317 0.2
318 0.15
319 0.14
320 0.14
321 0.15
322 0.19
323 0.26
324 0.24
325 0.26
326 0.34
327 0.37
328 0.44
329 0.54
330 0.56
331 0.58
332 0.64
333 0.7
334 0.7
335 0.75
336 0.73
337 0.68
338 0.7
339 0.65
340 0.64
341 0.58
342 0.5
343 0.41
344 0.37
345 0.35
346 0.28
347 0.34
348 0.33
349 0.39
350 0.45
351 0.53
352 0.61
353 0.64
354 0.71
355 0.7
356 0.76
357 0.77
358 0.81
359 0.83
360 0.83
361 0.84
362 0.82
363 0.78
364 0.76
365 0.76
366 0.75
367 0.73
368 0.75