Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GES0

Protein Details
Accession A0A2T4GES0   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
52-78VCTECIMKKRERRKKKEEEEKKLKEVEBasic
NLS Segment(s)
PositionSequence
59-74KKRERRKKKEEEEKKL
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
Amino Acid Sequences MCYKRTICLSCEDCGKAIKTTYDYGLCRIGRRANFWGMCRDAKMMHEALPGVCTECIMKKRERRKKKEEEEKKLKEVEEMNAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.26
4 0.24
5 0.24
6 0.22
7 0.22
8 0.24
9 0.26
10 0.25
11 0.25
12 0.3
13 0.28
14 0.26
15 0.28
16 0.3
17 0.27
18 0.31
19 0.32
20 0.32
21 0.34
22 0.34
23 0.35
24 0.32
25 0.31
26 0.27
27 0.25
28 0.18
29 0.17
30 0.18
31 0.14
32 0.12
33 0.12
34 0.12
35 0.11
36 0.11
37 0.1
38 0.08
39 0.07
40 0.07
41 0.07
42 0.11
43 0.15
44 0.18
45 0.26
46 0.33
47 0.45
48 0.56
49 0.66
50 0.72
51 0.79
52 0.86
53 0.9
54 0.93
55 0.93
56 0.93
57 0.93
58 0.91
59 0.86
60 0.79
61 0.68
62 0.63
63 0.55