Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GKU3

Protein Details
Accession A0A2T4GKU3   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-95AKKTPGRKRATKPKTPKTVGBasic
101-125GDYGSPKKVTPRKRRAPKAEVDDESHydrophilic
NLS Segment(s)
PositionSequence
74-92PPAKKTPGRKRATKPKTPK
107-118KKVTPRKRRAPK
Subcellular Location(s) nucl 17, cyto 4, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
CDD cd00167  SANT  
Amino Acid Sequences MSDSSTPKTNAWTEEAKNELLLRIIAQLKPEGKSINWNEISMEGRTMKSLQNQWTAVNKKIDAIKQQTADAPPPPAKKTPGRKRATKPKTPKTVGSDEDDGDYGSPKKVTPRKRRAPKAEVDDESPESSAKAIKMELNETIKAEDGGARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.33
4 0.31
5 0.29
6 0.25
7 0.19
8 0.17
9 0.12
10 0.14
11 0.16
12 0.16
13 0.17
14 0.21
15 0.22
16 0.23
17 0.25
18 0.22
19 0.19
20 0.28
21 0.3
22 0.35
23 0.34
24 0.32
25 0.31
26 0.31
27 0.33
28 0.24
29 0.22
30 0.14
31 0.13
32 0.14
33 0.15
34 0.15
35 0.19
36 0.23
37 0.26
38 0.3
39 0.3
40 0.32
41 0.38
42 0.39
43 0.38
44 0.36
45 0.31
46 0.28
47 0.31
48 0.31
49 0.29
50 0.31
51 0.31
52 0.29
53 0.3
54 0.29
55 0.27
56 0.26
57 0.21
58 0.19
59 0.19
60 0.2
61 0.22
62 0.22
63 0.25
64 0.31
65 0.41
66 0.48
67 0.54
68 0.58
69 0.64
70 0.72
71 0.79
72 0.8
73 0.79
74 0.79
75 0.78
76 0.83
77 0.78
78 0.74
79 0.69
80 0.67
81 0.59
82 0.54
83 0.46
84 0.36
85 0.34
86 0.28
87 0.22
88 0.15
89 0.15
90 0.1
91 0.09
92 0.09
93 0.09
94 0.18
95 0.26
96 0.36
97 0.46
98 0.56
99 0.66
100 0.77
101 0.87
102 0.88
103 0.88
104 0.86
105 0.84
106 0.82
107 0.73
108 0.66
109 0.6
110 0.53
111 0.46
112 0.37
113 0.28
114 0.2
115 0.18
116 0.16
117 0.13
118 0.12
119 0.12
120 0.14
121 0.17
122 0.19
123 0.25
124 0.27
125 0.27
126 0.27
127 0.27
128 0.25
129 0.22
130 0.2