Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GTL5

Protein Details
Accession A0A2T4GTL5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-36VLACVLCQQRKKKCDRKSPCSFCVKAHydrophilic
39-61QCIPSTPAPKRSRRKPTKELLARHydrophilic
NLS Segment(s)
PositionSequence
48-54KRSRRKP
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MASDQQRPPRVLACVLCQQRKKKCDRKSPCSFCVKAGIQCIPSTPAPKRSRRKPTKELLARLERCEELLKRCTCVQKSLMYSSYEHRDMASPTYTSTDGSNGSSSPEREKMGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.5
4 0.53
5 0.59
6 0.63
7 0.69
8 0.74
9 0.75
10 0.77
11 0.81
12 0.84
13 0.86
14 0.88
15 0.88
16 0.84
17 0.83
18 0.74
19 0.65
20 0.62
21 0.55
22 0.46
23 0.42
24 0.37
25 0.29
26 0.28
27 0.27
28 0.22
29 0.2
30 0.22
31 0.2
32 0.28
33 0.33
34 0.43
35 0.51
36 0.58
37 0.68
38 0.74
39 0.81
40 0.79
41 0.81
42 0.82
43 0.8
44 0.75
45 0.71
46 0.7
47 0.63
48 0.56
49 0.5
50 0.39
51 0.33
52 0.31
53 0.26
54 0.21
55 0.27
56 0.26
57 0.26
58 0.3
59 0.35
60 0.33
61 0.36
62 0.34
63 0.33
64 0.36
65 0.37
66 0.37
67 0.32
68 0.32
69 0.32
70 0.35
71 0.3
72 0.26
73 0.23
74 0.22
75 0.22
76 0.24
77 0.22
78 0.17
79 0.16
80 0.19
81 0.19
82 0.18
83 0.17
84 0.16
85 0.14
86 0.16
87 0.16
88 0.13
89 0.17
90 0.2
91 0.21
92 0.25
93 0.28