Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TQN6

Protein Details
Accession A0A2H9TQN6   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-105RHVKTHSRVTSRRRDKHDKMSITNBasic
NLS Segment(s)
Subcellular Location(s) cyto 9, nucl 6, mito 6, mito_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PF13894  zf-C2H2_4  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MLTYRSLPSPIVIALPVGAAPFPEPVRNSSRSFCCPIPDCGRAFFRDEHLQRHIRVHTGEKPFECDYPGCTSRFSRIDELQRHVKTHSRVTSRRRDKHDKMSITNLLNPKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.06
5 0.06
6 0.05
7 0.06
8 0.08
9 0.09
10 0.12
11 0.13
12 0.17
13 0.23
14 0.27
15 0.29
16 0.32
17 0.36
18 0.37
19 0.41
20 0.38
21 0.38
22 0.37
23 0.4
24 0.41
25 0.39
26 0.35
27 0.34
28 0.36
29 0.31
30 0.31
31 0.26
32 0.24
33 0.29
34 0.3
35 0.31
36 0.34
37 0.35
38 0.33
39 0.37
40 0.33
41 0.26
42 0.26
43 0.26
44 0.28
45 0.3
46 0.31
47 0.28
48 0.32
49 0.31
50 0.3
51 0.27
52 0.2
53 0.18
54 0.22
55 0.24
56 0.2
57 0.21
58 0.21
59 0.25
60 0.28
61 0.29
62 0.27
63 0.31
64 0.39
65 0.42
66 0.46
67 0.5
68 0.48
69 0.47
70 0.44
71 0.45
72 0.41
73 0.44
74 0.47
75 0.47
76 0.53
77 0.6
78 0.69
79 0.74
80 0.78
81 0.79
82 0.81
83 0.81
84 0.84
85 0.86
86 0.82
87 0.77
88 0.76
89 0.74
90 0.67
91 0.65