Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H9TFP0

Protein Details
Accession A0A2H9TFP0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-51GVVKPRRKLKPEQSKKTCRERTRBasic
60-80TLRPHVKRDTHPKKVPIQSKMHydrophilic
NLS Segment(s)
PositionSequence
32-73KPRRKLKPEQSKKTCRERTREREVVRKMTLRPHVKRDTHPKK
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 9.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLLSTVASPKMVILDPPMTYVQQPTVSAGVVKPRRKLKPEQSKKTCRERTREREVVRKMTLRPHVKRDTHPKKVPIQSKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.18
4 0.19
5 0.17
6 0.17
7 0.17
8 0.16
9 0.15
10 0.15
11 0.14
12 0.14
13 0.13
14 0.13
15 0.12
16 0.19
17 0.24
18 0.27
19 0.32
20 0.39
21 0.44
22 0.49
23 0.57
24 0.59
25 0.63
26 0.71
27 0.76
28 0.77
29 0.82
30 0.84
31 0.86
32 0.85
33 0.79
34 0.78
35 0.78
36 0.77
37 0.77
38 0.79
39 0.72
40 0.72
41 0.72
42 0.7
43 0.63
44 0.59
45 0.51
46 0.51
47 0.56
48 0.57
49 0.57
50 0.59
51 0.63
52 0.64
53 0.71
54 0.75
55 0.76
56 0.76
57 0.79
58 0.77
59 0.77
60 0.82