Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H9TQ42

Protein Details
Accession A0A2H9TQ42    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-34AGKPSSGGKAKKKKWSKGKVKEKSNNAVVHydrophilic
NLS Segment(s)
PositionSequence
7-28GKPSSGGKAKKKKWSKGKVKEK
Subcellular Location(s) nucl 13.5, mito_nucl 11.5, mito 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MTKAEAGKPSSGGKAKKKKWSKGKVKEKSNNAVVIDKATMDKLYKDVPTYKLITCSVLMDRMKINGSAARKVLAELEGKGLIKRVHSSASLNIYTRATAVAEEPVATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.69
4 0.76
5 0.79
6 0.84
7 0.87
8 0.88
9 0.88
10 0.92
11 0.91
12 0.92
13 0.91
14 0.88
15 0.85
16 0.78
17 0.71
18 0.61
19 0.54
20 0.43
21 0.35
22 0.27
23 0.2
24 0.15
25 0.12
26 0.11
27 0.09
28 0.09
29 0.09
30 0.11
31 0.12
32 0.13
33 0.16
34 0.18
35 0.21
36 0.23
37 0.22
38 0.22
39 0.22
40 0.21
41 0.18
42 0.16
43 0.13
44 0.16
45 0.16
46 0.14
47 0.14
48 0.14
49 0.14
50 0.13
51 0.14
52 0.12
53 0.14
54 0.15
55 0.15
56 0.15
57 0.15
58 0.15
59 0.15
60 0.14
61 0.13
62 0.11
63 0.13
64 0.14
65 0.14
66 0.14
67 0.16
68 0.15
69 0.15
70 0.17
71 0.17
72 0.17
73 0.19
74 0.21
75 0.23
76 0.28
77 0.29
78 0.28
79 0.28
80 0.26
81 0.25
82 0.22
83 0.18
84 0.12
85 0.1
86 0.11
87 0.11
88 0.11
89 0.11