Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TFZ0

Protein Details
Accession A0A2H9TFZ0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
7-32VKNPAEKKEHSQDRRRRLERDRRAKEBasic
NLS Segment(s)
PositionSequence
11-31AEKKEHSQDRRRRLERDRRAK
Subcellular Location(s) mito 9, plas 8, cyto 6, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAGARAVKNPAEKKEHSQDRRRRLERDRRAKETAQRILVPVLLAGLAVLVVLFFWKYGFGGVRSAATK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.65
3 0.66
4 0.7
5 0.73
6 0.76
7 0.84
8 0.81
9 0.78
10 0.78
11 0.8
12 0.81
13 0.83
14 0.8
15 0.76
16 0.76
17 0.72
18 0.69
19 0.67
20 0.61
21 0.52
22 0.45
23 0.39
24 0.34
25 0.31
26 0.23
27 0.14
28 0.09
29 0.05
30 0.05
31 0.04
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.03
41 0.03
42 0.04
43 0.04
44 0.06
45 0.09
46 0.1
47 0.13
48 0.14