Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TNK7

Protein Details
Accession A0A2H9TNK7   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-67TTEMSRTDRNRKRRQTKLVKKMQRQQSDHydrophilic
NLS Segment(s)
PositionSequence
48-97RNRKRRQTKLVKKMQRQQSDERARTAARLDPKKKGSLEKREALKTLSKNK
106-111RKDRRN
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012173  Mpp10  
Gene Ontology GO:0034457  C:Mpp10 complex  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04006  Mpp10  
Amino Acid Sequences MVRSISASMLEEATPLHMSSATRLAPQEHYRPSKNIPQATTEMSRTDRNRKRRQTKLVKKMQRQQSDERARTAARLDPKKKGSLEKREALKTLSKNKNVTILPQVRKDRRNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.1
5 0.1
6 0.12
7 0.17
8 0.15
9 0.16
10 0.17
11 0.19
12 0.24
13 0.28
14 0.33
15 0.36
16 0.41
17 0.43
18 0.45
19 0.48
20 0.5
21 0.52
22 0.5
23 0.43
24 0.41
25 0.41
26 0.41
27 0.39
28 0.32
29 0.27
30 0.25
31 0.29
32 0.29
33 0.37
34 0.41
35 0.49
36 0.58
37 0.66
38 0.73
39 0.77
40 0.84
41 0.84
42 0.88
43 0.88
44 0.88
45 0.86
46 0.84
47 0.84
48 0.83
49 0.79
50 0.74
51 0.7
52 0.7
53 0.71
54 0.65
55 0.59
56 0.51
57 0.43
58 0.39
59 0.34
60 0.28
61 0.27
62 0.35
63 0.37
64 0.42
65 0.46
66 0.5
67 0.51
68 0.57
69 0.58
70 0.59
71 0.63
72 0.62
73 0.65
74 0.63
75 0.62
76 0.55
77 0.53
78 0.5
79 0.53
80 0.55
81 0.55
82 0.54
83 0.54
84 0.59
85 0.53
86 0.49
87 0.49
88 0.49
89 0.49
90 0.55
91 0.63
92 0.64