Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3ALN6

Protein Details
Accession G3ALN6    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-39KPDFMNEKPKKESRKKKSGTPSNEASHydrophilic
122-141NEKPTSKKNSSKNVKDKKVEHydrophilic
NLS Segment(s)
PositionSequence
21-31KPKKESRKKKS
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
KEGG spaa:SPAPADRAFT_60614  -  
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MKLAASLSLPSGEKPDFMNEKPKKESRKKKSGTPSNEASLPNGEKPNFQGSRPNKKNIVPEQSLPNGEKPNFQPSKSKKSSHKEQSFPSGEKSNFQHSKSGSKSNFPQEQSLPSGEKPNFFNEKPTSKKNSSKNVKDKKVEDTYAGSSFHSSPLALNLPKPSFKASPKQGGADDELPSSSNSSVASSNSPVSTHGIAAGPGVPPPANAAPLTNPVTAYPPGSIPPPHIYQHPTPQQQYPYYPQFVQPGFSYQVTPQGYIQYQYPPYGQHHPQQMPQHPIYPHYQTPPPPHAAPQGIPPASQQQQQQPQQPAGGHKITFNELLSSSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.26
3 0.28
4 0.31
5 0.41
6 0.43
7 0.5
8 0.57
9 0.63
10 0.66
11 0.71
12 0.8
13 0.8
14 0.84
15 0.82
16 0.84
17 0.87
18 0.87
19 0.85
20 0.81
21 0.77
22 0.7
23 0.69
24 0.6
25 0.51
26 0.46
27 0.4
28 0.38
29 0.37
30 0.34
31 0.3
32 0.33
33 0.41
34 0.36
35 0.34
36 0.39
37 0.43
38 0.54
39 0.59
40 0.62
41 0.58
42 0.61
43 0.7
44 0.68
45 0.68
46 0.61
47 0.58
48 0.58
49 0.57
50 0.55
51 0.47
52 0.43
53 0.4
54 0.37
55 0.38
56 0.35
57 0.41
58 0.41
59 0.4
60 0.46
61 0.47
62 0.57
63 0.58
64 0.63
65 0.62
66 0.68
67 0.77
68 0.78
69 0.8
70 0.75
71 0.72
72 0.75
73 0.71
74 0.63
75 0.57
76 0.53
77 0.44
78 0.42
79 0.41
80 0.41
81 0.41
82 0.4
83 0.41
84 0.36
85 0.44
86 0.44
87 0.5
88 0.41
89 0.42
90 0.46
91 0.49
92 0.54
93 0.47
94 0.47
95 0.4
96 0.41
97 0.39
98 0.36
99 0.29
100 0.24
101 0.29
102 0.26
103 0.27
104 0.25
105 0.28
106 0.31
107 0.29
108 0.35
109 0.33
110 0.4
111 0.43
112 0.48
113 0.49
114 0.5
115 0.58
116 0.59
117 0.65
118 0.67
119 0.72
120 0.76
121 0.78
122 0.8
123 0.78
124 0.72
125 0.69
126 0.66
127 0.56
128 0.47
129 0.4
130 0.35
131 0.31
132 0.29
133 0.21
134 0.17
135 0.16
136 0.15
137 0.12
138 0.09
139 0.07
140 0.09
141 0.12
142 0.11
143 0.11
144 0.14
145 0.16
146 0.16
147 0.17
148 0.18
149 0.19
150 0.22
151 0.29
152 0.3
153 0.37
154 0.37
155 0.38
156 0.35
157 0.33
158 0.33
159 0.27
160 0.23
161 0.15
162 0.14
163 0.13
164 0.12
165 0.12
166 0.08
167 0.07
168 0.06
169 0.07
170 0.08
171 0.08
172 0.1
173 0.1
174 0.11
175 0.11
176 0.11
177 0.1
178 0.12
179 0.12
180 0.1
181 0.1
182 0.09
183 0.09
184 0.09
185 0.09
186 0.07
187 0.06
188 0.07
189 0.06
190 0.05
191 0.08
192 0.09
193 0.09
194 0.09
195 0.1
196 0.11
197 0.16
198 0.19
199 0.16
200 0.16
201 0.15
202 0.18
203 0.18
204 0.17
205 0.13
206 0.11
207 0.11
208 0.13
209 0.14
210 0.14
211 0.18
212 0.2
213 0.21
214 0.23
215 0.27
216 0.29
217 0.38
218 0.43
219 0.44
220 0.44
221 0.47
222 0.49
223 0.47
224 0.48
225 0.45
226 0.42
227 0.4
228 0.38
229 0.36
230 0.37
231 0.35
232 0.32
233 0.26
234 0.25
235 0.24
236 0.24
237 0.23
238 0.18
239 0.25
240 0.24
241 0.25
242 0.21
243 0.22
244 0.23
245 0.22
246 0.23
247 0.21
248 0.22
249 0.22
250 0.23
251 0.21
252 0.25
253 0.32
254 0.34
255 0.34
256 0.42
257 0.44
258 0.49
259 0.55
260 0.58
261 0.58
262 0.56
263 0.56
264 0.48
265 0.48
266 0.46
267 0.44
268 0.41
269 0.38
270 0.41
271 0.41
272 0.49
273 0.52
274 0.52
275 0.47
276 0.47
277 0.49
278 0.47
279 0.42
280 0.41
281 0.44
282 0.39
283 0.37
284 0.36
285 0.37
286 0.36
287 0.39
288 0.37
289 0.38
290 0.48
291 0.54
292 0.6
293 0.58
294 0.58
295 0.57
296 0.56
297 0.52
298 0.49
299 0.47
300 0.39
301 0.36
302 0.36
303 0.36
304 0.35
305 0.3
306 0.25
307 0.22