Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TQY7

Protein Details
Accession A0A2H9TQY7   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-27KFSPNVTSSRRKCRKAHFSAPSHVRRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto_nucl 3.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MKFSPNVTSSRRKCRKAHFSAPSHVRRVIMSAPLSKELRGKHDVKSLPIRKDDEVIVTRGTYKGREGKVVQVYRRRWVIHIERIQREKVNVNPSKVSITKIKMDKDRADLLKRKANGKSALQARRNAMQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.81
4 0.84
5 0.83
6 0.79
7 0.82
8 0.83
9 0.79
10 0.72
11 0.64
12 0.54
13 0.44
14 0.41
15 0.34
16 0.29
17 0.26
18 0.26
19 0.26
20 0.3
21 0.3
22 0.28
23 0.29
24 0.26
25 0.29
26 0.31
27 0.31
28 0.3
29 0.37
30 0.38
31 0.39
32 0.47
33 0.48
34 0.46
35 0.49
36 0.48
37 0.41
38 0.41
39 0.36
40 0.31
41 0.25
42 0.22
43 0.18
44 0.16
45 0.15
46 0.15
47 0.15
48 0.11
49 0.12
50 0.17
51 0.17
52 0.21
53 0.21
54 0.26
55 0.33
56 0.37
57 0.38
58 0.4
59 0.42
60 0.42
61 0.45
62 0.4
63 0.33
64 0.37
65 0.39
66 0.4
67 0.46
68 0.49
69 0.52
70 0.54
71 0.55
72 0.49
73 0.45
74 0.4
75 0.38
76 0.41
77 0.39
78 0.39
79 0.38
80 0.38
81 0.4
82 0.37
83 0.34
84 0.3
85 0.29
86 0.33
87 0.37
88 0.42
89 0.44
90 0.5
91 0.51
92 0.51
93 0.55
94 0.54
95 0.57
96 0.58
97 0.58
98 0.59
99 0.58
100 0.59
101 0.56
102 0.58
103 0.55
104 0.53
105 0.55
106 0.57
107 0.63
108 0.62
109 0.63
110 0.6