Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H9TP51

Protein Details
Accession A0A2H9TP51    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
128-148KTPSWRKPRGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
113-118KKRTKK
130-150PSWRKPRGIDNRVRRRFKGNK
Subcellular Location(s) mito 11, nucl 10, cyto 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015865  Riboflavin_kinase_bac/euk  
IPR023465  Riboflavin_kinase_dom_sf  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0005524  F:ATP binding  
GO:0008531  F:riboflavin kinase activity  
GO:0003735  F:structural constituent of ribosome  
GO:0009398  P:FMN biosynthetic process  
GO:0009231  P:riboflavin biosynthetic process  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01687  Flavokinase  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MQRYPGDSDNSPAIQLLLGWCKLKSHRHLSRFAQLYSMDSTVAGPNSEFPLVQRLQILISSEYEVHLMDYNGPDFYGKELLVVIAGHLRPEKNFNTIGAALMPKALNQVKIVKKRTKKFVRFESDEFKTPSWRKPRGIDNRVRRRFKGNKAMPGIGFGSNAATRHMMPNGFRKIVINNAEELEMLLLQNRIFAAEVAHNVSARKRLAIVQRAKELDIKLTNPHARLVVAENA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.15
5 0.16
6 0.17
7 0.17
8 0.21
9 0.27
10 0.35
11 0.4
12 0.46
13 0.54
14 0.59
15 0.67
16 0.69
17 0.72
18 0.69
19 0.61
20 0.53
21 0.44
22 0.41
23 0.35
24 0.3
25 0.2
26 0.15
27 0.16
28 0.14
29 0.15
30 0.12
31 0.09
32 0.1
33 0.12
34 0.13
35 0.11
36 0.1
37 0.16
38 0.16
39 0.17
40 0.16
41 0.15
42 0.15
43 0.16
44 0.18
45 0.12
46 0.12
47 0.13
48 0.12
49 0.12
50 0.12
51 0.1
52 0.09
53 0.09
54 0.08
55 0.08
56 0.09
57 0.1
58 0.09
59 0.09
60 0.09
61 0.08
62 0.09
63 0.1
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.07
70 0.06
71 0.07
72 0.07
73 0.08
74 0.09
75 0.1
76 0.1
77 0.15
78 0.16
79 0.16
80 0.17
81 0.16
82 0.18
83 0.18
84 0.18
85 0.14
86 0.13
87 0.1
88 0.1
89 0.1
90 0.06
91 0.1
92 0.1
93 0.1
94 0.12
95 0.19
96 0.25
97 0.32
98 0.39
99 0.43
100 0.5
101 0.55
102 0.65
103 0.68
104 0.7
105 0.7
106 0.73
107 0.74
108 0.72
109 0.69
110 0.66
111 0.58
112 0.53
113 0.47
114 0.37
115 0.36
116 0.33
117 0.37
118 0.39
119 0.42
120 0.42
121 0.45
122 0.54
123 0.58
124 0.65
125 0.67
126 0.69
127 0.75
128 0.81
129 0.81
130 0.72
131 0.71
132 0.71
133 0.71
134 0.71
135 0.66
136 0.65
137 0.66
138 0.66
139 0.57
140 0.5
141 0.43
142 0.32
143 0.25
144 0.17
145 0.14
146 0.12
147 0.12
148 0.11
149 0.1
150 0.1
151 0.12
152 0.14
153 0.14
154 0.16
155 0.24
156 0.29
157 0.28
158 0.28
159 0.27
160 0.27
161 0.32
162 0.35
163 0.27
164 0.23
165 0.23
166 0.23
167 0.22
168 0.2
169 0.13
170 0.09
171 0.07
172 0.07
173 0.07
174 0.07
175 0.08
176 0.07
177 0.07
178 0.07
179 0.08
180 0.09
181 0.1
182 0.12
183 0.14
184 0.15
185 0.15
186 0.16
187 0.18
188 0.22
189 0.2
190 0.2
191 0.18
192 0.24
193 0.32
194 0.41
195 0.48
196 0.49
197 0.56
198 0.56
199 0.56
200 0.55
201 0.47
202 0.45
203 0.4
204 0.35
205 0.33
206 0.4
207 0.43
208 0.4
209 0.41
210 0.35
211 0.31
212 0.31