Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H9TLU4

Protein Details
Accession A0A2H9TLU4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
93-120DAQSKQKEKALQRRKEERRKRDVNDDDDBasic
NLS Segment(s)
PositionSequence
99-113KEKALQRRKEERRKR
Subcellular Location(s) nucl 17, mito_nucl 11.999, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038567  T_Elf1_sf  
Amino Acid Sequences MGVFVVTPKKACSSSKVMSNVFLSRSLSSLLDLFDIKAPSTSEIRKITAQSTVQVIILFSLTPVQGPLDSDQSQLADLSEPVDIFAEWIDAIDAQSKQKEKALQRRKEERRKRDVNDDDDDDKEERKEDESVDEDAEEEEEEEEEDDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.43
3 0.48
4 0.45
5 0.45
6 0.46
7 0.42
8 0.35
9 0.33
10 0.27
11 0.21
12 0.21
13 0.19
14 0.16
15 0.15
16 0.14
17 0.12
18 0.11
19 0.11
20 0.11
21 0.12
22 0.13
23 0.12
24 0.12
25 0.13
26 0.14
27 0.17
28 0.18
29 0.21
30 0.23
31 0.26
32 0.26
33 0.27
34 0.26
35 0.28
36 0.27
37 0.21
38 0.21
39 0.19
40 0.17
41 0.16
42 0.14
43 0.09
44 0.08
45 0.07
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.05
52 0.04
53 0.06
54 0.07
55 0.11
56 0.11
57 0.12
58 0.12
59 0.12
60 0.12
61 0.11
62 0.09
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.06
80 0.07
81 0.08
82 0.12
83 0.13
84 0.14
85 0.18
86 0.24
87 0.3
88 0.41
89 0.5
90 0.55
91 0.64
92 0.74
93 0.81
94 0.86
95 0.88
96 0.87
97 0.87
98 0.88
99 0.84
100 0.84
101 0.82
102 0.77
103 0.73
104 0.68
105 0.6
106 0.52
107 0.49
108 0.39
109 0.33
110 0.27
111 0.22
112 0.18
113 0.18
114 0.18
115 0.16
116 0.2
117 0.21
118 0.22
119 0.22
120 0.2
121 0.18
122 0.17
123 0.16
124 0.11
125 0.09
126 0.08
127 0.07
128 0.07
129 0.08