Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TI73

Protein Details
Accession A0A2H9TI73    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25VKKTPSKPVRKEATPKKPKTSSNDDHydrophilic
NLS Segment(s)
PositionSequence
7-17KPVRKEATPKK
Subcellular Location(s) nucl 16, cyto_nucl 11.833, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004123  Dim1  
IPR036249  Thioredoxin-like_sf  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF02966  DIM1  
PF08265  YL1_C  
CDD cd02954  DIM1  
Amino Acid Sequences VKKTPSKPVRKEATPKKPKTSSNDDSAGDNTECLPFKKSSYVTPTRRTKPQKVTAHTVPPSVLPRRRYCDVTGLPAQYVEPRTGMRYYGAEVYPVSYFLTHLTNGWQVDQAILGEEERIVLVRFGHDWDKECMKMDEILYSVAEKVKQWCVVYVVDLKETPDFTAMYELYDACTVMFFWRNRHMQVDLGTGNNNKINWALDSKQELLDILEVVYKGARKGKGLVVSPRDYSTRVKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.86
4 0.84
5 0.82
6 0.8
7 0.79
8 0.74
9 0.7
10 0.68
11 0.59
12 0.54
13 0.48
14 0.44
15 0.34
16 0.28
17 0.21
18 0.19
19 0.2
20 0.19
21 0.21
22 0.18
23 0.2
24 0.26
25 0.27
26 0.3
27 0.38
28 0.47
29 0.5
30 0.59
31 0.66
32 0.65
33 0.74
34 0.76
35 0.76
36 0.77
37 0.8
38 0.8
39 0.76
40 0.79
41 0.75
42 0.75
43 0.67
44 0.58
45 0.48
46 0.41
47 0.41
48 0.4
49 0.39
50 0.37
51 0.41
52 0.47
53 0.5
54 0.5
55 0.47
56 0.48
57 0.44
58 0.44
59 0.42
60 0.37
61 0.33
62 0.3
63 0.28
64 0.22
65 0.21
66 0.15
67 0.12
68 0.11
69 0.14
70 0.14
71 0.14
72 0.13
73 0.12
74 0.13
75 0.15
76 0.15
77 0.13
78 0.12
79 0.13
80 0.12
81 0.11
82 0.1
83 0.07
84 0.07
85 0.07
86 0.09
87 0.07
88 0.08
89 0.09
90 0.11
91 0.11
92 0.12
93 0.11
94 0.09
95 0.09
96 0.09
97 0.07
98 0.05
99 0.05
100 0.05
101 0.04
102 0.04
103 0.04
104 0.03
105 0.04
106 0.03
107 0.04
108 0.04
109 0.04
110 0.05
111 0.06
112 0.09
113 0.1
114 0.12
115 0.15
116 0.17
117 0.17
118 0.18
119 0.17
120 0.16
121 0.17
122 0.15
123 0.13
124 0.11
125 0.11
126 0.1
127 0.09
128 0.09
129 0.08
130 0.08
131 0.08
132 0.1
133 0.13
134 0.16
135 0.16
136 0.16
137 0.18
138 0.17
139 0.19
140 0.2
141 0.18
142 0.16
143 0.16
144 0.16
145 0.15
146 0.15
147 0.14
148 0.1
149 0.1
150 0.09
151 0.12
152 0.11
153 0.11
154 0.11
155 0.1
156 0.1
157 0.1
158 0.1
159 0.06
160 0.06
161 0.06
162 0.07
163 0.14
164 0.14
165 0.18
166 0.26
167 0.29
168 0.31
169 0.34
170 0.33
171 0.3
172 0.31
173 0.33
174 0.26
175 0.24
176 0.25
177 0.23
178 0.24
179 0.23
180 0.21
181 0.16
182 0.16
183 0.16
184 0.16
185 0.2
186 0.19
187 0.22
188 0.26
189 0.27
190 0.27
191 0.26
192 0.23
193 0.19
194 0.19
195 0.14
196 0.1
197 0.1
198 0.09
199 0.09
200 0.11
201 0.11
202 0.13
203 0.19
204 0.21
205 0.21
206 0.25
207 0.31
208 0.37
209 0.42
210 0.48
211 0.49
212 0.51
213 0.52
214 0.5
215 0.47
216 0.42