Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TIU9

Protein Details
Accession A0A2H9TIU9    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-83VMCSWALKKHQRYRKEFPNYPKSRKAIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 1, cyto 1, plas 1, cyto_nucl 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001104  3-oxo-5_a-steroid_4-DH_C  
IPR039357  SRD5A/TECR  
Gene Ontology GO:0016020  C:membrane  
GO:0016627  F:oxidoreductase activity, acting on the CH-CH group of donors  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF02544  Steroid_dh  
PROSITE View protein in PROSITE  
PS50244  S5A_REDUCTASE  
Amino Acid Sequences LRNLRPKGSTTRGIPRGLGFGLVSCPNYTFETLAWTAMSVMTGLISMWVFTTIGGIVMCSWALKKHQRYRKEFPNYPKSRKAIFPFVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.45
3 0.41
4 0.34
5 0.29
6 0.18
7 0.13
8 0.14
9 0.14
10 0.14
11 0.11
12 0.12
13 0.13
14 0.14
15 0.15
16 0.12
17 0.11
18 0.14
19 0.14
20 0.14
21 0.11
22 0.1
23 0.09
24 0.08
25 0.08
26 0.04
27 0.04
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.04
37 0.03
38 0.04
39 0.03
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.12
50 0.2
51 0.3
52 0.4
53 0.49
54 0.59
55 0.67
56 0.75
57 0.8
58 0.82
59 0.8
60 0.81
61 0.84
62 0.83
63 0.82
64 0.82
65 0.76
66 0.71
67 0.71
68 0.68