Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TR26

Protein Details
Accession A0A2H9TR26   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTINQKTRLKNKKFIRKLKQKEEILSHydrophilic
NLS Segment(s)
PositionSequence
10-17KNKKFIRK
Subcellular Location(s) mito 14, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
Amino Acid Sequences MTINQKTRLKNKKFIRKLKQKEEILSQPFIKGLTIKVYTMTPKKPNSALRKVAKVKLNKGVGSKKQTIITAYIPKEKHTLSIHNLVLVRAGKTKDLPGLKYKIVRGVLDCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.92
5 0.92
6 0.92
7 0.86
8 0.8
9 0.77
10 0.74
11 0.67
12 0.61
13 0.51
14 0.41
15 0.36
16 0.31
17 0.24
18 0.16
19 0.13
20 0.14
21 0.14
22 0.14
23 0.15
24 0.16
25 0.21
26 0.25
27 0.29
28 0.3
29 0.32
30 0.35
31 0.39
32 0.46
33 0.5
34 0.53
35 0.56
36 0.54
37 0.6
38 0.61
39 0.61
40 0.58
41 0.54
42 0.5
43 0.49
44 0.48
45 0.41
46 0.42
47 0.44
48 0.44
49 0.46
50 0.45
51 0.39
52 0.38
53 0.37
54 0.34
55 0.29
56 0.28
57 0.28
58 0.28
59 0.31
60 0.3
61 0.3
62 0.32
63 0.3
64 0.31
65 0.27
66 0.3
67 0.29
68 0.36
69 0.35
70 0.35
71 0.35
72 0.3
73 0.3
74 0.26
75 0.23
76 0.19
77 0.2
78 0.19
79 0.2
80 0.23
81 0.26
82 0.29
83 0.31
84 0.34
85 0.39
86 0.41
87 0.45
88 0.45
89 0.45
90 0.44
91 0.43