Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TJQ6

Protein Details
Accession A0A2H9TJQ6   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MVQRLTYRRRHAYRTKSNKVRVVKTPHydrophilic
NLS Segment(s)
PositionSequence
90-126KKVLKTKTKDAPAEKPAPEKAKTDKAAPSKKKKTMAR
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PF00203  Ribosomal_S19  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MVQRLTYRRRHAYRTKSNKVRVVKTPGGKLTYLYVDKRAGAIPSIRPHQYTQLSKGRKTVTRAYGGSRCASCVRNRIVRAFLIEEQKIVKKVLKTKTKDAPAEKPAPEKAKTDKAAPSKKKKTMARALWKGPFFQMSLLNAIKRDTKREGVRVTARNNTIIPAFVGSRLLVHNGKEFQPLVVREEMVGQKISAFVACTKPRTYRATNANKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.86
4 0.88
5 0.87
6 0.85
7 0.81
8 0.78
9 0.77
10 0.74
11 0.7
12 0.69
13 0.65
14 0.6
15 0.53
16 0.45
17 0.39
18 0.37
19 0.36
20 0.3
21 0.29
22 0.28
23 0.28
24 0.28
25 0.26
26 0.2
27 0.18
28 0.2
29 0.22
30 0.26
31 0.3
32 0.3
33 0.31
34 0.32
35 0.37
36 0.41
37 0.4
38 0.42
39 0.47
40 0.5
41 0.49
42 0.54
43 0.52
44 0.49
45 0.5
46 0.51
47 0.47
48 0.49
49 0.49
50 0.48
51 0.47
52 0.44
53 0.42
54 0.34
55 0.3
56 0.27
57 0.28
58 0.26
59 0.28
60 0.32
61 0.35
62 0.37
63 0.37
64 0.37
65 0.34
66 0.34
67 0.3
68 0.28
69 0.26
70 0.24
71 0.22
72 0.21
73 0.22
74 0.21
75 0.19
76 0.18
77 0.17
78 0.25
79 0.33
80 0.4
81 0.43
82 0.48
83 0.55
84 0.59
85 0.61
86 0.58
87 0.55
88 0.52
89 0.54
90 0.48
91 0.43
92 0.4
93 0.39
94 0.36
95 0.32
96 0.31
97 0.33
98 0.33
99 0.33
100 0.36
101 0.41
102 0.49
103 0.55
104 0.61
105 0.62
106 0.66
107 0.72
108 0.7
109 0.71
110 0.71
111 0.72
112 0.72
113 0.7
114 0.7
115 0.67
116 0.63
117 0.55
118 0.45
119 0.37
120 0.27
121 0.21
122 0.18
123 0.13
124 0.17
125 0.17
126 0.17
127 0.16
128 0.17
129 0.22
130 0.21
131 0.25
132 0.25
133 0.31
134 0.36
135 0.42
136 0.43
137 0.44
138 0.51
139 0.52
140 0.52
141 0.52
142 0.48
143 0.43
144 0.41
145 0.35
146 0.28
147 0.22
148 0.18
149 0.13
150 0.12
151 0.1
152 0.11
153 0.09
154 0.1
155 0.1
156 0.14
157 0.14
158 0.15
159 0.19
160 0.21
161 0.23
162 0.25
163 0.25
164 0.22
165 0.26
166 0.26
167 0.25
168 0.24
169 0.23
170 0.2
171 0.25
172 0.25
173 0.21
174 0.21
175 0.16
176 0.15
177 0.15
178 0.16
179 0.11
180 0.11
181 0.11
182 0.19
183 0.24
184 0.27
185 0.31
186 0.36
187 0.42
188 0.48
189 0.51
190 0.51
191 0.58
192 0.65