Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TME0

Protein Details
Accession A0A2H9TME0   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
62-91LELLKNSKDKRARKLAKRRKKLEELNGVLAHydrophilic
NLS Segment(s)
PositionSequence
29-40KPSHRKGGISKR
66-82KNSKDKRARKLAKRRKK
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAAVKVAKSGIAVGANHGHIVTPRAVPAKPSHRKGGISKRVKFIRDLVREVTGFAPYERRILELLKNSKDKRARKLAKRRKKLEELNGVLAESRRAAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.15
5 0.13
6 0.11
7 0.13
8 0.13
9 0.1
10 0.13
11 0.15
12 0.15
13 0.17
14 0.24
15 0.32
16 0.39
17 0.43
18 0.46
19 0.47
20 0.51
21 0.57
22 0.61
23 0.6
24 0.61
25 0.61
26 0.63
27 0.64
28 0.61
29 0.55
30 0.51
31 0.5
32 0.45
33 0.43
34 0.37
35 0.35
36 0.33
37 0.33
38 0.26
39 0.17
40 0.13
41 0.11
42 0.12
43 0.1
44 0.13
45 0.12
46 0.12
47 0.12
48 0.14
49 0.18
50 0.24
51 0.29
52 0.33
53 0.41
54 0.41
55 0.48
56 0.55
57 0.57
58 0.57
59 0.62
60 0.67
61 0.7
62 0.8
63 0.84
64 0.86
65 0.91
66 0.91
67 0.89
68 0.89
69 0.88
70 0.87
71 0.86
72 0.81
73 0.77
74 0.68
75 0.59
76 0.5
77 0.41
78 0.32