Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TPZ4

Protein Details
Accession A0A2H9TPZ4   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MFYGCNQKGKWRGQHQRDTSRDWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 8, cyto 5, pero 2
Family & Domain DBs
Amino Acid Sequences MFYGCNQKGKWRGQHQRDTSRDWSHPQANPPVTKRTTRQEGPGWWREVTVINQGSTVKTIVTTCRNGRIYKEESVKRESPAGTDWAGFAASTFHMYQNSGNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.85
4 0.81
5 0.79
6 0.75
7 0.7
8 0.64
9 0.58
10 0.56
11 0.52
12 0.51
13 0.49
14 0.5
15 0.49
16 0.51
17 0.49
18 0.5
19 0.46
20 0.46
21 0.45
22 0.45
23 0.47
24 0.44
25 0.46
26 0.44
27 0.48
28 0.51
29 0.53
30 0.48
31 0.4
32 0.38
33 0.33
34 0.3
35 0.24
36 0.23
37 0.18
38 0.15
39 0.16
40 0.17
41 0.16
42 0.15
43 0.13
44 0.07
45 0.06
46 0.07
47 0.1
48 0.14
49 0.18
50 0.19
51 0.26
52 0.29
53 0.3
54 0.32
55 0.35
56 0.36
57 0.38
58 0.45
59 0.43
60 0.44
61 0.5
62 0.5
63 0.45
64 0.44
65 0.38
66 0.31
67 0.28
68 0.27
69 0.22
70 0.2
71 0.18
72 0.14
73 0.14
74 0.12
75 0.09
76 0.08
77 0.07
78 0.1
79 0.11
80 0.12
81 0.13
82 0.14