Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TLS5

Protein Details
Accession A0A2H9TLS5   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-45SERQWRPGRELKRERQLQRKLRRERRLQRERQWKLEQBasic
NLS Segment(s)
PositionSequence
14-37RPGRELKRERQLQRKLRRERRLQR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences ALRSVCRESERQWRPGRELKRERQLQRKLRRERRLQRERQWKLEQELELEQESELELDLEHELELDLEQEWEWDLEKELGLEEELEQEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.66
3 0.7
4 0.7
5 0.74
6 0.74
7 0.76
8 0.8
9 0.8
10 0.82
11 0.84
12 0.83
13 0.83
14 0.84
15 0.85
16 0.86
17 0.88
18 0.89
19 0.89
20 0.9
21 0.9
22 0.89
23 0.88
24 0.89
25 0.84
26 0.81
27 0.77
28 0.69
29 0.61
30 0.56
31 0.46
32 0.38
33 0.33
34 0.27
35 0.21
36 0.18
37 0.14
38 0.09
39 0.09
40 0.06
41 0.05
42 0.04
43 0.03
44 0.04
45 0.04
46 0.05
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.04
53 0.04
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.07
60 0.07
61 0.09
62 0.09
63 0.1
64 0.1
65 0.1
66 0.1
67 0.09
68 0.1
69 0.08