Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H9TM27

Protein Details
Accession A0A2H9TM27   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-117GLITVTKSGRKQRKEKKNRAKKVRGSLKHKKSAAGBasic
NLS Segment(s)
PositionSequence
89-119KSGRKQRKEKKNRAKKVRGSLKHKKSAAGKK
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MTNRLLMRKQMVLDVVHPNSASVAKVALREKLATMYKCDKDAIVVFGFKLAFGGGKSTGFALIYDTVVAAKKFEPKYRLARQGLITVTKSGRKQRKEKKNRAKKVRGSLKHKKSAAGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.27
4 0.26
5 0.23
6 0.21
7 0.2
8 0.17
9 0.09
10 0.1
11 0.1
12 0.14
13 0.16
14 0.17
15 0.18
16 0.18
17 0.18
18 0.22
19 0.27
20 0.23
21 0.28
22 0.32
23 0.32
24 0.33
25 0.33
26 0.27
27 0.24
28 0.24
29 0.21
30 0.15
31 0.14
32 0.12
33 0.13
34 0.13
35 0.1
36 0.09
37 0.06
38 0.05
39 0.05
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.06
54 0.07
55 0.07
56 0.06
57 0.07
58 0.14
59 0.17
60 0.21
61 0.24
62 0.28
63 0.38
64 0.45
65 0.53
66 0.49
67 0.5
68 0.48
69 0.5
70 0.46
71 0.4
72 0.33
73 0.27
74 0.27
75 0.27
76 0.3
77 0.35
78 0.42
79 0.48
80 0.57
81 0.65
82 0.75
83 0.81
84 0.88
85 0.9
86 0.92
87 0.95
88 0.95
89 0.95
90 0.93
91 0.93
92 0.93
93 0.91
94 0.9
95 0.9
96 0.89
97 0.88
98 0.81
99 0.77