Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4C2V6

Protein Details
Accession A0A2T4C2V6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-42VSPVWNNKRLRRKHMKTESCTPLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 7, E.R. 3, cyto 2, extr 2
Family & Domain DBs
Amino Acid Sequences MREISTSCPDKRSSRSLLVVSPVWNNKRLRRKHMKTESCTPLVYMCNFFVALARVVCESLISCMCICMSDVFGSVSSPRRETLRGWSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.49
4 0.46
5 0.44
6 0.4
7 0.34
8 0.33
9 0.33
10 0.31
11 0.35
12 0.37
13 0.41
14 0.49
15 0.54
16 0.59
17 0.64
18 0.69
19 0.74
20 0.81
21 0.82
22 0.78
23 0.81
24 0.76
25 0.67
26 0.59
27 0.48
28 0.39
29 0.31
30 0.26
31 0.18
32 0.12
33 0.11
34 0.11
35 0.1
36 0.09
37 0.09
38 0.09
39 0.07
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.07
55 0.09
56 0.08
57 0.09
58 0.1
59 0.1
60 0.11
61 0.13
62 0.19
63 0.2
64 0.21
65 0.22
66 0.24
67 0.27
68 0.28