Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4C5Q4

Protein Details
Accession A0A2T4C5Q4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
46-73ISLLNARNQAKPKRRKTRAKSNQNSKTKHydrophilic
NLS Segment(s)
PositionSequence
55-73AKPKRRKTRAKSNQNSKTK
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKCTTKQAKHSAEQPKTTCTITQTDSLDKRLVFMLCSKVICIIIIISLLNARNQAKPKRRKTRAKSNQNSKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.57
3 0.52
4 0.49
5 0.41
6 0.33
7 0.3
8 0.24
9 0.27
10 0.25
11 0.29
12 0.29
13 0.3
14 0.3
15 0.26
16 0.25
17 0.22
18 0.2
19 0.14
20 0.15
21 0.16
22 0.15
23 0.15
24 0.14
25 0.13
26 0.12
27 0.12
28 0.09
29 0.06
30 0.05
31 0.05
32 0.05
33 0.04
34 0.05
35 0.06
36 0.07
37 0.1
38 0.11
39 0.16
40 0.24
41 0.33
42 0.42
43 0.52
44 0.63
45 0.71
46 0.8
47 0.87
48 0.89
49 0.91
50 0.92
51 0.93
52 0.93
53 0.93