Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4C8N7

Protein Details
Accession A0A2T4C8N7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-86HSSVKKRCEHCKVVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASFLRTLSLTAGLLRSSPAAAAAVAKGSFATANPVSAWMGWMARPAVGGALQQTRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKANPRHKQRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.08
5 0.08
6 0.07
7 0.07
8 0.07
9 0.07
10 0.07
11 0.08
12 0.07
13 0.07
14 0.07
15 0.06
16 0.06
17 0.06
18 0.11
19 0.09
20 0.1
21 0.1
22 0.11
23 0.11
24 0.11
25 0.11
26 0.07
27 0.07
28 0.06
29 0.08
30 0.07
31 0.06
32 0.07
33 0.06
34 0.06
35 0.05
36 0.05
37 0.06
38 0.07
39 0.07
40 0.08
41 0.09
42 0.09
43 0.1
44 0.11
45 0.1
46 0.11
47 0.2
48 0.26
49 0.34
50 0.39
51 0.46
52 0.53
53 0.57
54 0.63
55 0.63
56 0.65
57 0.67
58 0.72
59 0.75
60 0.78
61 0.82
62 0.81
63 0.81
64 0.82
65 0.83
66 0.84
67 0.81
68 0.79
69 0.77
70 0.72
71 0.68
72 0.64
73 0.57
74 0.5
75 0.43
76 0.35
77 0.35
78 0.39
79 0.45
80 0.48
81 0.54