Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BQE3

Protein Details
Accession A0A2T4BQE3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
177-204REEGLRQTSDRRRRQSNQRRLMPKPAAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MCCSRILGCWWTGSGICSHIEDAFIVVWTLFTDIKKSCSIIQLHAYRKIPATASASHKTRSSRTAQSSFAAANREIKRKAHHLDTSNRKKHMDLFSPNISYKAPKQGGLQTAIESAPCSPTCVLRLASQGSLLLSPSPPPLSLLCRIPLQACASKYIHTDRAPSTSGCKNHALLCCREEGLRQTSDRRRRQSNQRRLMPKPAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.15
4 0.14
5 0.15
6 0.13
7 0.13
8 0.12
9 0.12
10 0.1
11 0.09
12 0.08
13 0.07
14 0.06
15 0.06
16 0.08
17 0.08
18 0.08
19 0.12
20 0.13
21 0.17
22 0.18
23 0.2
24 0.2
25 0.25
26 0.27
27 0.27
28 0.34
29 0.39
30 0.41
31 0.47
32 0.46
33 0.41
34 0.41
35 0.38
36 0.31
37 0.27
38 0.27
39 0.25
40 0.3
41 0.35
42 0.36
43 0.35
44 0.38
45 0.37
46 0.36
47 0.36
48 0.35
49 0.37
50 0.42
51 0.44
52 0.43
53 0.41
54 0.39
55 0.35
56 0.31
57 0.25
58 0.19
59 0.23
60 0.25
61 0.3
62 0.3
63 0.31
64 0.33
65 0.37
66 0.41
67 0.39
68 0.41
69 0.42
70 0.5
71 0.58
72 0.65
73 0.64
74 0.63
75 0.56
76 0.51
77 0.52
78 0.5
79 0.46
80 0.4
81 0.39
82 0.4
83 0.42
84 0.41
85 0.35
86 0.28
87 0.23
88 0.2
89 0.23
90 0.2
91 0.19
92 0.21
93 0.25
94 0.27
95 0.28
96 0.27
97 0.19
98 0.19
99 0.17
100 0.15
101 0.11
102 0.09
103 0.08
104 0.08
105 0.09
106 0.09
107 0.1
108 0.11
109 0.13
110 0.15
111 0.14
112 0.16
113 0.17
114 0.16
115 0.16
116 0.14
117 0.12
118 0.11
119 0.1
120 0.08
121 0.06
122 0.07
123 0.08
124 0.09
125 0.08
126 0.1
127 0.11
128 0.14
129 0.17
130 0.19
131 0.19
132 0.2
133 0.2
134 0.2
135 0.21
136 0.22
137 0.24
138 0.22
139 0.25
140 0.25
141 0.26
142 0.28
143 0.3
144 0.32
145 0.28
146 0.32
147 0.29
148 0.32
149 0.33
150 0.31
151 0.31
152 0.32
153 0.33
154 0.33
155 0.34
156 0.31
157 0.35
158 0.41
159 0.4
160 0.37
161 0.37
162 0.35
163 0.33
164 0.32
165 0.29
166 0.28
167 0.29
168 0.29
169 0.3
170 0.37
171 0.46
172 0.56
173 0.63
174 0.65
175 0.69
176 0.74
177 0.83
178 0.85
179 0.86
180 0.86
181 0.87
182 0.87
183 0.83
184 0.85