Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4C3F5

Protein Details
Accession A0A2T4C3F5   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-51ALSNFKSSQHKGKKKRTPPPPRSKVIGHydrophilic
85-113REEVKVAKEKERKKPPQWNNKKKKQNQKEBasic
NLS Segment(s)
PositionSequence
34-69HKGKKKRTPPPPRSKVIGSIRRQQKQSSSKSKSKQP
87-112EVKVAKEKERKKPPQWNNKKKKQNQK
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MRYPARISSYIQEIALVAFRCPSDALSNFKSSQHKGKKKRTPPPPRSKVIGSIRRQQKQSSSKSKSKQPIAPTRSRYTVSCPKLREEVKVAKEKERKKPPQWNNKKKKQNQKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.17
4 0.12
5 0.12
6 0.11
7 0.12
8 0.12
9 0.13
10 0.14
11 0.17
12 0.23
13 0.25
14 0.29
15 0.29
16 0.34
17 0.37
18 0.35
19 0.43
20 0.48
21 0.54
22 0.6
23 0.7
24 0.76
25 0.81
26 0.87
27 0.88
28 0.89
29 0.9
30 0.91
31 0.88
32 0.82
33 0.76
34 0.68
35 0.66
36 0.64
37 0.62
38 0.55
39 0.56
40 0.6
41 0.6
42 0.6
43 0.52
44 0.51
45 0.51
46 0.55
47 0.57
48 0.56
49 0.6
50 0.63
51 0.7
52 0.69
53 0.67
54 0.64
55 0.62
56 0.65
57 0.64
58 0.67
59 0.65
60 0.61
61 0.58
62 0.55
63 0.47
64 0.45
65 0.48
66 0.46
67 0.46
68 0.44
69 0.44
70 0.5
71 0.5
72 0.46
73 0.44
74 0.46
75 0.48
76 0.55
77 0.54
78 0.55
79 0.62
80 0.66
81 0.7
82 0.72
83 0.75
84 0.76
85 0.85
86 0.86
87 0.89
88 0.92
89 0.93
90 0.93
91 0.94
92 0.95
93 0.94