Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BQS2

Protein Details
Accession A0A2T4BQS2    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-90TAQQPAKKPKSKTKKKMDPSKYATRYHydrophilic
NLS Segment(s)
PositionSequence
70-80AKKPKSKTKKK
Subcellular Location(s) nucl 17, cyto_nucl 11.833, mito_nucl 10.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR001406  PsdUridine_synth_TruA  
IPR020094  TruA/RsuA/RluB/E/F_N  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
Amino Acid Sequences MSDQGTYNNWTKAGLIQRVKELEKQLKASSSSHEAISTTASDQQQPAKSEHEHEQQQKQDDQSETAQQPAKKPKSKTKKKMDPSKYATRYIALKLAYLGKNFGGFEFQAMGNQPSIEEELWNALTKACLIFPEDERVVDFECCEYSKCGRTDRGVSAFGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.36
4 0.42
5 0.46
6 0.47
7 0.46
8 0.47
9 0.46
10 0.46
11 0.48
12 0.44
13 0.44
14 0.44
15 0.41
16 0.37
17 0.34
18 0.31
19 0.27
20 0.25
21 0.22
22 0.2
23 0.2
24 0.16
25 0.11
26 0.14
27 0.15
28 0.15
29 0.16
30 0.22
31 0.25
32 0.26
33 0.27
34 0.26
35 0.27
36 0.29
37 0.34
38 0.35
39 0.38
40 0.41
41 0.46
42 0.46
43 0.49
44 0.47
45 0.42
46 0.4
47 0.34
48 0.31
49 0.26
50 0.27
51 0.24
52 0.25
53 0.27
54 0.24
55 0.28
56 0.36
57 0.42
58 0.43
59 0.47
60 0.54
61 0.62
62 0.72
63 0.77
64 0.78
65 0.8
66 0.84
67 0.89
68 0.87
69 0.85
70 0.82
71 0.82
72 0.74
73 0.67
74 0.58
75 0.49
76 0.43
77 0.34
78 0.31
79 0.2
80 0.16
81 0.15
82 0.2
83 0.19
84 0.18
85 0.17
86 0.14
87 0.15
88 0.15
89 0.14
90 0.1
91 0.08
92 0.09
93 0.1
94 0.09
95 0.09
96 0.1
97 0.11
98 0.1
99 0.1
100 0.09
101 0.08
102 0.1
103 0.09
104 0.08
105 0.08
106 0.1
107 0.11
108 0.11
109 0.1
110 0.09
111 0.09
112 0.09
113 0.1
114 0.08
115 0.07
116 0.09
117 0.12
118 0.14
119 0.21
120 0.21
121 0.2
122 0.21
123 0.22
124 0.22
125 0.19
126 0.18
127 0.12
128 0.13
129 0.14
130 0.15
131 0.17
132 0.2
133 0.26
134 0.29
135 0.34
136 0.37
137 0.42
138 0.47
139 0.51
140 0.51