Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4BR03

Protein Details
Accession A0A2T4BR03    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-27RKLACRLCQKRKKKCNRKSPCSMCIKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 11, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences RKLACRLCQKRKKKCNRKSPCSMCIKLKVVCQPSAPAAPRKRRQSTKDLFARLAWCEEQLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.94
4 0.93
5 0.93
6 0.9
7 0.88
8 0.85
9 0.79
10 0.73
11 0.69
12 0.64
13 0.55
14 0.5
15 0.47
16 0.41
17 0.38
18 0.33
19 0.28
20 0.25
21 0.28
22 0.26
23 0.28
24 0.33
25 0.41
26 0.49
27 0.57
28 0.64
29 0.68
30 0.72
31 0.74
32 0.75
33 0.75
34 0.76
35 0.71
36 0.64
37 0.57
38 0.54
39 0.45
40 0.42
41 0.32
42 0.26