Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4C3T6

Protein Details
Accession A0A2T4C3T6   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
82-102IQRVVRQRVKRHFFPHHCSCRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9, mito 8, nucl 7, cyto 7, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MSGPLFVLLSLTHDTQVSLTHAKQDVRRYEVYKSIQCFFQHLNGVPSRAIPRQGSEGEGGNQNIHSICSSCETAAQSDTLDIQRVVRQRVKRHFFPHHCSCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.14
4 0.14
5 0.15
6 0.15
7 0.19
8 0.23
9 0.26
10 0.3
11 0.36
12 0.38
13 0.4
14 0.44
15 0.41
16 0.4
17 0.45
18 0.46
19 0.42
20 0.4
21 0.36
22 0.36
23 0.34
24 0.34
25 0.28
26 0.26
27 0.25
28 0.23
29 0.25
30 0.22
31 0.22
32 0.19
33 0.19
34 0.18
35 0.16
36 0.18
37 0.14
38 0.15
39 0.17
40 0.18
41 0.18
42 0.16
43 0.16
44 0.14
45 0.16
46 0.15
47 0.12
48 0.11
49 0.1
50 0.09
51 0.09
52 0.08
53 0.06
54 0.07
55 0.1
56 0.11
57 0.1
58 0.12
59 0.13
60 0.14
61 0.14
62 0.14
63 0.11
64 0.1
65 0.13
66 0.11
67 0.12
68 0.11
69 0.12
70 0.16
71 0.2
72 0.26
73 0.31
74 0.37
75 0.46
76 0.56
77 0.63
78 0.67
79 0.72
80 0.77
81 0.79
82 0.81