Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4C8C0

Protein Details
Accession A0A2T4C8C0   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MKKRGRRSCAVLERQRKRARGRFDGCKTVRBasic
NLS Segment(s)
PositionSequence
195-209IKARRRGAMIGRARR
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
Amino Acid Sequences MKKRGRRSCAVLERQRKRARGRFDGCKTVRCYRTPCVASASAGGSKQQCSCTHARGSRARASMDCMRRSRRSSEDGGERKDGRDAAAAGDDAERCRQKEEERGGRGQKMQVNLEVDVSSKVNQWKPLEKKALVTSKRRRDRQLAPPVTTSSPSAFLGATTLEAPACLVEGTSTARCCMLPRYIRGACQPWWAKEIKARRRGAMIGRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.82
4 0.81
5 0.79
6 0.78
7 0.78
8 0.78
9 0.79
10 0.78
11 0.81
12 0.74
13 0.72
14 0.69
15 0.68
16 0.65
17 0.59
18 0.58
19 0.53
20 0.61
21 0.55
22 0.51
23 0.47
24 0.43
25 0.38
26 0.34
27 0.31
28 0.23
29 0.21
30 0.23
31 0.18
32 0.19
33 0.2
34 0.23
35 0.21
36 0.25
37 0.29
38 0.31
39 0.37
40 0.39
41 0.44
42 0.47
43 0.51
44 0.53
45 0.51
46 0.48
47 0.4
48 0.43
49 0.44
50 0.44
51 0.44
52 0.43
53 0.47
54 0.51
55 0.53
56 0.53
57 0.5
58 0.48
59 0.46
60 0.46
61 0.5
62 0.5
63 0.5
64 0.49
65 0.45
66 0.4
67 0.38
68 0.32
69 0.23
70 0.19
71 0.16
72 0.11
73 0.11
74 0.11
75 0.09
76 0.1
77 0.09
78 0.08
79 0.11
80 0.12
81 0.11
82 0.13
83 0.15
84 0.16
85 0.24
86 0.32
87 0.37
88 0.39
89 0.44
90 0.44
91 0.44
92 0.43
93 0.39
94 0.33
95 0.27
96 0.25
97 0.22
98 0.21
99 0.2
100 0.19
101 0.15
102 0.13
103 0.11
104 0.11
105 0.09
106 0.1
107 0.14
108 0.15
109 0.2
110 0.22
111 0.3
112 0.35
113 0.42
114 0.46
115 0.43
116 0.44
117 0.46
118 0.53
119 0.5
120 0.55
121 0.57
122 0.61
123 0.7
124 0.72
125 0.71
126 0.69
127 0.72
128 0.73
129 0.74
130 0.7
131 0.64
132 0.61
133 0.58
134 0.52
135 0.44
136 0.35
137 0.25
138 0.21
139 0.18
140 0.16
141 0.13
142 0.12
143 0.11
144 0.1
145 0.09
146 0.07
147 0.07
148 0.06
149 0.06
150 0.06
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.05
157 0.09
158 0.12
159 0.12
160 0.13
161 0.14
162 0.14
163 0.16
164 0.19
165 0.24
166 0.27
167 0.31
168 0.4
169 0.41
170 0.44
171 0.49
172 0.49
173 0.43
174 0.47
175 0.48
176 0.42
177 0.44
178 0.43
179 0.39
180 0.43
181 0.51
182 0.51
183 0.56
184 0.57
185 0.56
186 0.59
187 0.62
188 0.62
189 0.61