Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4CJ31

Protein Details
Accession A0A2T4CJ31   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-98ICTKKWLKMRGRDERSQSRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 2, mito 1, pero 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009145  U2AF_small  
IPR000571  Znf_CCCH  
Gene Ontology GO:0089701  C:U2AF complex  
GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MANFLASIFGTELDKVNCSFYFKIGACRHGDRCSRKHVKPSYSQTILMPNLYQNPAYDPKNRMNASQLQNHFDAFYEDICTKKWLKMRGRDERSQSRSPTPEPSRRRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.16
4 0.16
5 0.2
6 0.19
7 0.18
8 0.24
9 0.23
10 0.32
11 0.32
12 0.36
13 0.35
14 0.4
15 0.42
16 0.43
17 0.5
18 0.48
19 0.49
20 0.55
21 0.6
22 0.58
23 0.64
24 0.65
25 0.63
26 0.65
27 0.69
28 0.67
29 0.61
30 0.58
31 0.49
32 0.47
33 0.41
34 0.32
35 0.24
36 0.16
37 0.15
38 0.15
39 0.14
40 0.09
41 0.12
42 0.16
43 0.18
44 0.22
45 0.23
46 0.27
47 0.35
48 0.35
49 0.32
50 0.33
51 0.38
52 0.38
53 0.42
54 0.4
55 0.35
56 0.35
57 0.34
58 0.3
59 0.22
60 0.2
61 0.13
62 0.11
63 0.11
64 0.11
65 0.12
66 0.13
67 0.16
68 0.15
69 0.19
70 0.24
71 0.3
72 0.39
73 0.48
74 0.58
75 0.66
76 0.72
77 0.75
78 0.79
79 0.81
80 0.79
81 0.76
82 0.7
83 0.67
84 0.65
85 0.61
86 0.63
87 0.61
88 0.64