Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BZ88

Protein Details
Accession A0A2T4BZ88   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-45NDGIPKPRGKPGPKKKPRLEDGTIBasic
NLS Segment(s)
PositionSequence
26-39PKPRGKPGPKKKPR
Subcellular Location(s) nucl 20, mito_nucl 13.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013175  INO80_su_Ies4  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08193  INO80_Ies4  
Amino Acid Sequences MPPPTTKKGVKRSATAVNGNNNDGIPKPRGKPGPKKKPRLEDGTIDHSGATGRPSAHKLGPKANQGAINAGLRALDRSGKPCRRWAKGGFKLKSFTGVVWEIPRWTAPPRTVPESGAEDSAAPSAEGSNKENKENGNENENENENGNEGNSVSKSESGADVEMQSAPSIQASSPAPVPVVAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.65
3 0.6
4 0.59
5 0.56
6 0.52
7 0.47
8 0.38
9 0.32
10 0.27
11 0.26
12 0.21
13 0.25
14 0.26
15 0.33
16 0.42
17 0.5
18 0.59
19 0.66
20 0.73
21 0.78
22 0.86
23 0.87
24 0.89
25 0.87
26 0.84
27 0.77
28 0.73
29 0.69
30 0.65
31 0.57
32 0.47
33 0.39
34 0.31
35 0.26
36 0.19
37 0.14
38 0.09
39 0.09
40 0.11
41 0.14
42 0.17
43 0.21
44 0.25
45 0.27
46 0.33
47 0.38
48 0.4
49 0.4
50 0.4
51 0.38
52 0.34
53 0.33
54 0.27
55 0.22
56 0.17
57 0.14
58 0.11
59 0.09
60 0.09
61 0.07
62 0.08
63 0.09
64 0.13
65 0.23
66 0.29
67 0.31
68 0.39
69 0.45
70 0.46
71 0.52
72 0.55
73 0.57
74 0.6
75 0.68
76 0.62
77 0.57
78 0.55
79 0.49
80 0.44
81 0.33
82 0.24
83 0.17
84 0.16
85 0.15
86 0.14
87 0.15
88 0.11
89 0.11
90 0.12
91 0.1
92 0.11
93 0.14
94 0.14
95 0.21
96 0.24
97 0.29
98 0.3
99 0.29
100 0.29
101 0.3
102 0.29
103 0.23
104 0.2
105 0.15
106 0.14
107 0.14
108 0.11
109 0.06
110 0.05
111 0.05
112 0.08
113 0.1
114 0.12
115 0.19
116 0.21
117 0.23
118 0.25
119 0.25
120 0.29
121 0.34
122 0.35
123 0.33
124 0.33
125 0.34
126 0.35
127 0.36
128 0.31
129 0.24
130 0.22
131 0.16
132 0.15
133 0.13
134 0.1
135 0.08
136 0.09
137 0.09
138 0.1
139 0.11
140 0.11
141 0.12
142 0.13
143 0.14
144 0.13
145 0.14
146 0.13
147 0.12
148 0.13
149 0.13
150 0.12
151 0.11
152 0.09
153 0.09
154 0.08
155 0.09
156 0.07
157 0.11
158 0.12
159 0.15
160 0.16
161 0.17
162 0.16
163 0.16