Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BSM6

Protein Details
Accession A0A2T4BSM6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
249-281DESRNDTKSSRSRKKKRSSKKKSDKNEPASPSSHydrophilic
NLS Segment(s)
PositionSequence
257-273SSRSRKKKRSSKKKSDK
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039773  BAG_chaperone_regulator  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MAVQCAFLLRVLSQGHLDTQDAKVDSSQPIVASSGALQHIIANYLNGTITNLSAAFQESSEFISGTLGVPPTFIYSGLAALVALPITMSRYGWSLNREQSFGASSGGVPDVTNEDFSYITAQDLDDPRVEYTDTRYYPRPRSRGPSEPEDDILLIKSKGVTYPAHFPAYSIGDGKLYVKDVRERIGLLMDLPSRTTRRIKLLYKGKQLKDSSAPVRDYGVKNKSELMAVIPDVDDDNSGRSEDDMIIVDESRNDTKSSRSRKKKRSSKKKSDKNEPASPSSPVDSGSNADAANAPSPTVVNAAMKKLDDISDEFHTNWLPLCLDYIEAPPKDAKKRDEEHRKLSESVMQQIILKLDGVETEGVDEIRQRRKDLVRRVQEVLKRLDIAKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.19
4 0.2
5 0.18
6 0.18
7 0.22
8 0.21
9 0.21
10 0.2
11 0.22
12 0.22
13 0.22
14 0.22
15 0.17
16 0.17
17 0.17
18 0.16
19 0.13
20 0.12
21 0.14
22 0.13
23 0.12
24 0.11
25 0.12
26 0.12
27 0.13
28 0.13
29 0.1
30 0.09
31 0.1
32 0.1
33 0.08
34 0.09
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.09
41 0.1
42 0.09
43 0.09
44 0.1
45 0.09
46 0.11
47 0.12
48 0.11
49 0.09
50 0.09
51 0.1
52 0.09
53 0.11
54 0.1
55 0.09
56 0.09
57 0.09
58 0.11
59 0.11
60 0.11
61 0.1
62 0.09
63 0.09
64 0.09
65 0.09
66 0.06
67 0.06
68 0.06
69 0.04
70 0.04
71 0.03
72 0.03
73 0.05
74 0.06
75 0.06
76 0.06
77 0.08
78 0.1
79 0.13
80 0.17
81 0.21
82 0.28
83 0.29
84 0.3
85 0.29
86 0.28
87 0.28
88 0.24
89 0.19
90 0.13
91 0.11
92 0.11
93 0.11
94 0.1
95 0.08
96 0.07
97 0.09
98 0.1
99 0.1
100 0.09
101 0.09
102 0.09
103 0.1
104 0.11
105 0.08
106 0.08
107 0.08
108 0.08
109 0.11
110 0.12
111 0.14
112 0.13
113 0.14
114 0.14
115 0.14
116 0.15
117 0.11
118 0.15
119 0.21
120 0.21
121 0.24
122 0.31
123 0.36
124 0.45
125 0.53
126 0.54
127 0.52
128 0.59
129 0.62
130 0.64
131 0.63
132 0.62
133 0.57
134 0.52
135 0.48
136 0.4
137 0.33
138 0.24
139 0.2
140 0.13
141 0.1
142 0.08
143 0.08
144 0.07
145 0.08
146 0.1
147 0.11
148 0.11
149 0.19
150 0.21
151 0.23
152 0.22
153 0.22
154 0.22
155 0.23
156 0.21
157 0.15
158 0.12
159 0.11
160 0.11
161 0.12
162 0.1
163 0.09
164 0.1
165 0.1
166 0.15
167 0.15
168 0.17
169 0.17
170 0.17
171 0.15
172 0.15
173 0.14
174 0.09
175 0.11
176 0.09
177 0.09
178 0.09
179 0.1
180 0.11
181 0.14
182 0.17
183 0.17
184 0.23
185 0.3
186 0.32
187 0.4
188 0.49
189 0.53
190 0.6
191 0.66
192 0.62
193 0.62
194 0.6
195 0.54
196 0.48
197 0.46
198 0.41
199 0.37
200 0.36
201 0.29
202 0.3
203 0.31
204 0.29
205 0.31
206 0.32
207 0.28
208 0.28
209 0.29
210 0.27
211 0.23
212 0.21
213 0.15
214 0.1
215 0.1
216 0.09
217 0.08
218 0.07
219 0.07
220 0.07
221 0.06
222 0.05
223 0.06
224 0.06
225 0.07
226 0.06
227 0.06
228 0.08
229 0.07
230 0.08
231 0.08
232 0.08
233 0.08
234 0.08
235 0.08
236 0.07
237 0.1
238 0.1
239 0.1
240 0.11
241 0.11
242 0.18
243 0.27
244 0.37
245 0.45
246 0.55
247 0.65
248 0.75
249 0.85
250 0.89
251 0.92
252 0.93
253 0.94
254 0.94
255 0.95
256 0.94
257 0.93
258 0.94
259 0.93
260 0.9
261 0.88
262 0.81
263 0.76
264 0.68
265 0.6
266 0.51
267 0.42
268 0.33
269 0.26
270 0.21
271 0.16
272 0.15
273 0.14
274 0.13
275 0.11
276 0.11
277 0.12
278 0.12
279 0.13
280 0.11
281 0.1
282 0.09
283 0.09
284 0.09
285 0.09
286 0.09
287 0.11
288 0.13
289 0.15
290 0.17
291 0.17
292 0.17
293 0.17
294 0.17
295 0.15
296 0.15
297 0.17
298 0.19
299 0.21
300 0.2
301 0.2
302 0.2
303 0.18
304 0.17
305 0.15
306 0.11
307 0.1
308 0.11
309 0.1
310 0.11
311 0.12
312 0.15
313 0.21
314 0.2
315 0.22
316 0.25
317 0.31
318 0.38
319 0.43
320 0.44
321 0.47
322 0.54
323 0.63
324 0.7
325 0.72
326 0.74
327 0.76
328 0.75
329 0.67
330 0.62
331 0.58
332 0.5
333 0.48
334 0.4
335 0.33
336 0.29
337 0.29
338 0.28
339 0.21
340 0.18
341 0.12
342 0.1
343 0.1
344 0.1
345 0.09
346 0.08
347 0.08
348 0.09
349 0.09
350 0.09
351 0.14
352 0.19
353 0.28
354 0.31
355 0.32
356 0.4
357 0.49
358 0.59
359 0.65
360 0.69
361 0.7
362 0.73
363 0.76
364 0.76
365 0.71
366 0.69
367 0.64
368 0.57
369 0.5
370 0.45