Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BTN2

Protein Details
Accession A0A2T4BTN2   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-29LTDGRPTLRPRKRPSFYKQRRLPFETIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCLTDGRPTLRPRKRPSFYKQRRLPFETIFLLHPSLAFYFPSSLFLFVRLCRLPTYYLIQLLWTFSVHISIAAMTDATRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.82
4 0.83
5 0.84
6 0.86
7 0.85
8 0.84
9 0.84
10 0.81
11 0.76
12 0.67
13 0.61
14 0.52
15 0.45
16 0.36
17 0.29
18 0.23
19 0.18
20 0.16
21 0.12
22 0.1
23 0.09
24 0.08
25 0.07
26 0.08
27 0.08
28 0.11
29 0.1
30 0.11
31 0.1
32 0.12
33 0.12
34 0.11
35 0.16
36 0.14
37 0.14
38 0.14
39 0.16
40 0.16
41 0.18
42 0.23
43 0.2
44 0.21
45 0.2
46 0.21
47 0.19
48 0.18
49 0.16
50 0.11
51 0.1
52 0.08
53 0.1
54 0.09
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07