FuNGI

A0A2T4CA59

Protein Details

Accession

A0A2T4CA59

Localization Confidence

Low

Confidence Score

9.9

NoLS Segment(s)

Position	Sequence	Protein Nature
439-468	REIPPKPVLSKRGKPKTKNLQPTYKKGQGV	Hydrophilic

NLS Segment(s)

Position	Sequence
448-455	SKRGKPKT

Subcellular Location(s)

mito 8, nucl 5, plas 5, cyto 4, pero 2, E.R. 2

Family & Domain DBs

InterPro	View protein in InterPro IPR023395 Mt_carrier_dom_sf
Gene Ontology	GO:0005743 C:mitochondrial inner membrane

Amino Acid Sequences

MSYTKEHAVNPLRPYHRPPTIEERAEPVSIPSSNPFSGGNSYDVASGAKYASKAKNMLNDLDYKELMSDSPSVVESARELVDELIWKYMSVLLGQPFEVAKMILQVRDQDDKAALAVPAEPETPVAAPQVPSRAGSAFEGEDSENDEPAYFTTNDPAIPNPWGSNPPQPERRPSSRRAESPLRSPTTPKKVPAVPEHFLILRRPDAVLDVIGQLWQRDGAWGVWKGANATFLYTVLHSLLENWSRSFLSAVLNVPDLGVRDNIDRLVDIAAPYPWASLFVAAAAAVTTSLVLAPLDLVRTRLILTNPFKGQRRTIASLRALPSYYCPPKIVVPTILHSLVNPIFTLSTPLALKTKFMLTSEIAPMTFSAAKFFASSVGMLIKLPLETVLRRGQLSVLSEPEYLEALNDGEPALETIVPVGKYFGTFGTMYHIAAEEGTREIPPKPVLSKRGKPKTKNLQPTYKKGQGVEGLLRGWRISWWGLAGLWMANMVGHGGDGEF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.6
2	0.6
3	0.6
4	0.57
5	0.58
6	0.59
7	0.64
8	0.64
9	0.58
10	0.55
11	0.5
12	0.48
13	0.41
14	0.33
15	0.28
16	0.24
17	0.24
18	0.22
19	0.24
20	0.23
21	0.24
22	0.23
23	0.21
24	0.24
25	0.24
26	0.23
27	0.19
28	0.19
29	0.19
30	0.18
31	0.16
32	0.12
33	0.11
34	0.1
35	0.11
36	0.12
37	0.18
38	0.22
39	0.27
40	0.31
41	0.34
42	0.41
43	0.43
44	0.45
45	0.41
46	0.42
47	0.4
48	0.4
49	0.36
50	0.28
51	0.25
52	0.21
53	0.18
54	0.15
55	0.14
56	0.1
57	0.11
58	0.11
59	0.11
60	0.11
61	0.11
62	0.1
63	0.11
64	0.11
65	0.1
66	0.1
67	0.1
68	0.11
69	0.13
70	0.13
71	0.13
72	0.13
73	0.12
74	0.12
75	0.14
76	0.13
77	0.11
78	0.14
79	0.14
80	0.15
81	0.15
82	0.16
83	0.13
84	0.13
85	0.13
86	0.1
87	0.07
88	0.11
89	0.13
90	0.13
91	0.14
92	0.17
93	0.21
94	0.26
95	0.26
96	0.22
97	0.22
98	0.21
99	0.2
100	0.18
101	0.14
102	0.09
103	0.1
104	0.09
105	0.1
106	0.1
107	0.09
108	0.08
109	0.09
110	0.09
111	0.09
112	0.09
113	0.09
114	0.1
115	0.12
116	0.15
117	0.15
118	0.15
119	0.16
120	0.16
121	0.16
122	0.15
123	0.16
124	0.12
125	0.11
126	0.12
127	0.11
128	0.1
129	0.13
130	0.13
131	0.11
132	0.11
133	0.1
134	0.09
135	0.09
136	0.13
137	0.1
138	0.1
139	0.12
140	0.13
141	0.13
142	0.14
143	0.15
144	0.13
145	0.13
146	0.14
147	0.13
148	0.14
149	0.16
150	0.18
151	0.24
152	0.28
153	0.33
154	0.41
155	0.42
156	0.48
157	0.54
158	0.6
159	0.6
160	0.61
161	0.64
162	0.63
163	0.64
164	0.64
165	0.65
166	0.59
167	0.61
168	0.63
169	0.56
170	0.49
171	0.5
172	0.51
173	0.52
174	0.52
175	0.46
176	0.44
177	0.43
178	0.47
179	0.52
180	0.5
181	0.42
182	0.39
183	0.39
184	0.34
185	0.32
186	0.29
187	0.22
188	0.16
189	0.15
190	0.14
191	0.12
192	0.12
193	0.12
194	0.1
195	0.08
196	0.08
197	0.07
198	0.08
199	0.08
200	0.07
201	0.06
202	0.06
203	0.05
204	0.05
205	0.06
206	0.06
207	0.1
208	0.11
209	0.12
210	0.13
211	0.13
212	0.14
213	0.13
214	0.14
215	0.1
216	0.1
217	0.09
218	0.08
219	0.09
220	0.08
221	0.08
222	0.06
223	0.06
224	0.05
225	0.06
226	0.08
227	0.1
228	0.11
229	0.11
230	0.12
231	0.12
232	0.12
233	0.12
234	0.09
235	0.08
236	0.09
237	0.1
238	0.09
239	0.1
240	0.09
241	0.09
242	0.08
243	0.07
244	0.06
245	0.06
246	0.06
247	0.06
248	0.07
249	0.07
250	0.07
251	0.07
252	0.06
253	0.07
254	0.07
255	0.06
256	0.07
257	0.06
258	0.07
259	0.07
260	0.06
261	0.05
262	0.06
263	0.06
264	0.05
265	0.05
266	0.05
267	0.05
268	0.04
269	0.04
270	0.03
271	0.03
272	0.02
273	0.02
274	0.02
275	0.02
276	0.02
277	0.02
278	0.02
279	0.02
280	0.03
281	0.03
282	0.04
283	0.05
284	0.06
285	0.06
286	0.07
287	0.08
288	0.1
289	0.11
290	0.18
291	0.21
292	0.25
293	0.28
294	0.32
295	0.36
296	0.36
297	0.37
298	0.36
299	0.4
300	0.4
301	0.4
302	0.42
303	0.41
304	0.44
305	0.43
306	0.38
307	0.31
308	0.26
309	0.26
310	0.28
311	0.29
312	0.25
313	0.24
314	0.24
315	0.27
316	0.3
317	0.3
318	0.26
319	0.24
320	0.25
321	0.28
322	0.27
323	0.24
324	0.2
325	0.21
326	0.17
327	0.16
328	0.13
329	0.1
330	0.1
331	0.1
332	0.13
333	0.09
334	0.11
335	0.11
336	0.12
337	0.15
338	0.15
339	0.16
340	0.14
341	0.17
342	0.15
343	0.16
344	0.18
345	0.16
346	0.2
347	0.21
348	0.2
349	0.17
350	0.16
351	0.15
352	0.15
353	0.16
354	0.13
355	0.12
356	0.12
357	0.12
358	0.12
359	0.12
360	0.11
361	0.09
362	0.09
363	0.08
364	0.09
365	0.09
366	0.08
367	0.09
368	0.08
369	0.07
370	0.07
371	0.07
372	0.09
373	0.09
374	0.13
375	0.18
376	0.2
377	0.2
378	0.2
379	0.2
380	0.21
381	0.24
382	0.22
383	0.2
384	0.2
385	0.2
386	0.2
387	0.2
388	0.17
389	0.13
390	0.11
391	0.09
392	0.07
393	0.07
394	0.07
395	0.06
396	0.06
397	0.06
398	0.07
399	0.07
400	0.06
401	0.05
402	0.06
403	0.1
404	0.1
405	0.1
406	0.11
407	0.1
408	0.1
409	0.12
410	0.11
411	0.11
412	0.11
413	0.11
414	0.16
415	0.17
416	0.16
417	0.16
418	0.16
419	0.13
420	0.13
421	0.14
422	0.08
423	0.09
424	0.1
425	0.1
426	0.11
427	0.12
428	0.17
429	0.19
430	0.22
431	0.28
432	0.35
433	0.43
434	0.52
435	0.6
436	0.66
437	0.75
438	0.8
439	0.8
440	0.84
441	0.86
442	0.87
443	0.89
444	0.87
445	0.87
446	0.85
447	0.87
448	0.86
449	0.82
450	0.75
451	0.65
452	0.62
453	0.56
454	0.54
455	0.49
456	0.42
457	0.36
458	0.34
459	0.33
460	0.27
461	0.22
462	0.17
463	0.16
464	0.14
465	0.14
466	0.14
467	0.15
468	0.15
469	0.16
470	0.16
471	0.13
472	0.11
473	0.1
474	0.08
475	0.07
476	0.07
477	0.06
478	0.05
479	0.04

A0A2T4CA59

3D AlphaFold-predicted Structure Viewer