Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4BRT3

Protein Details
Accession A0A2T4BRT3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-22RYITRLKRPHGYKRPLSESAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MRRYITRLKRPHGYKRPLSESAAKKRMHAKLLEFEARFNSARTYDHFCEPVSPSVVPYHHAEVMDIVAPWMYPYYDDDQSSGMYPHYEDNHLSEMMARVQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.8
4 0.74
5 0.71
6 0.69
7 0.67
8 0.68
9 0.67
10 0.58
11 0.54
12 0.58
13 0.59
14 0.55
15 0.49
16 0.42
17 0.41
18 0.47
19 0.5
20 0.41
21 0.37
22 0.33
23 0.33
24 0.29
25 0.23
26 0.18
27 0.13
28 0.14
29 0.17
30 0.23
31 0.22
32 0.23
33 0.24
34 0.22
35 0.24
36 0.24
37 0.23
38 0.17
39 0.15
40 0.14
41 0.15
42 0.15
43 0.15
44 0.15
45 0.16
46 0.15
47 0.15
48 0.14
49 0.12
50 0.13
51 0.11
52 0.09
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.07
61 0.12
62 0.15
63 0.16
64 0.16
65 0.17
66 0.18
67 0.18
68 0.16
69 0.12
70 0.1
71 0.1
72 0.14
73 0.15
74 0.17
75 0.17
76 0.2
77 0.22
78 0.22
79 0.21
80 0.19
81 0.18