Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4CIU9

Protein Details
Accession A0A2T4CIU9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-71AAPPAIKSRKDLPKKTKKTYKKKQNIVPVKKPGPGHydrophilic
NLS Segment(s)
PositionSequence
42-79IKSRKDLPKKTKKTYKKKQNIVPVKKPGPGERKAFRKR
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019368  Ribosomal_S23/S29_mit  
IPR017082  Ribosomal_S23_mit_fun  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF10236  DAP3  
Amino Acid Sequences MASISLRSLVRPSLPVAPRIQPIIIAAFSTTSLVSAAAPPAIKSRKDLPKKTKKTYKKKQNIVPVKKPGPGERKAFRKRIQLSNNSALPVTGLGELEAETMARAESAGRMFAVPDEVVDRLRALEAFKSTQTWNLFRKPHVLVRKETVELMSRLEASVEKKEALKCVLTGSRLSGKSLMLLQAMSYALLNEWVVIHIPEGQDLTNGNTEYSPVPDTEPMQFTQPVYCLRLLQNIYKANKAVLEKTPLKQDWSRLSATLKPGSTLADLALSAKESEFAWPTLSALWTELTQEGQPPVLFALDGLAHINKVSAYRDPAFNPVHAHELLLVRAFVDALSGKTKLPNGGAVIAATSQNNTHFHPSQELALSQLEAGQAGKPVPQPDPYERKYDDRVYDALKHSTVMRLEGVSKEEARVLMEYWGASGMLRSALDSRVVAEKWALGGHGIVGEMERASLITMRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.38
4 0.4
5 0.4
6 0.41
7 0.38
8 0.29
9 0.28
10 0.27
11 0.22
12 0.17
13 0.15
14 0.12
15 0.12
16 0.13
17 0.11
18 0.07
19 0.07
20 0.07
21 0.08
22 0.09
23 0.09
24 0.11
25 0.11
26 0.12
27 0.2
28 0.25
29 0.25
30 0.28
31 0.37
32 0.45
33 0.56
34 0.65
35 0.68
36 0.75
37 0.84
38 0.9
39 0.91
40 0.92
41 0.93
42 0.94
43 0.94
44 0.93
45 0.93
46 0.91
47 0.92
48 0.92
49 0.91
50 0.89
51 0.88
52 0.82
53 0.77
54 0.72
55 0.7
56 0.67
57 0.64
58 0.62
59 0.6
60 0.66
61 0.7
62 0.76
63 0.73
64 0.75
65 0.75
66 0.77
67 0.79
68 0.77
69 0.76
70 0.75
71 0.71
72 0.61
73 0.54
74 0.43
75 0.33
76 0.25
77 0.18
78 0.1
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.05
86 0.04
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.06
93 0.07
94 0.08
95 0.08
96 0.08
97 0.09
98 0.09
99 0.11
100 0.08
101 0.08
102 0.09
103 0.09
104 0.09
105 0.1
106 0.09
107 0.08
108 0.09
109 0.09
110 0.09
111 0.11
112 0.13
113 0.15
114 0.15
115 0.17
116 0.17
117 0.22
118 0.25
119 0.28
120 0.3
121 0.36
122 0.39
123 0.37
124 0.43
125 0.41
126 0.45
127 0.49
128 0.48
129 0.44
130 0.46
131 0.49
132 0.44
133 0.4
134 0.34
135 0.29
136 0.25
137 0.23
138 0.18
139 0.15
140 0.14
141 0.14
142 0.14
143 0.13
144 0.16
145 0.15
146 0.15
147 0.18
148 0.19
149 0.21
150 0.21
151 0.19
152 0.16
153 0.18
154 0.2
155 0.18
156 0.17
157 0.18
158 0.23
159 0.22
160 0.23
161 0.21
162 0.18
163 0.18
164 0.18
165 0.17
166 0.1
167 0.1
168 0.08
169 0.08
170 0.08
171 0.07
172 0.06
173 0.05
174 0.04
175 0.05
176 0.05
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.05
183 0.06
184 0.06
185 0.07
186 0.07
187 0.07
188 0.07
189 0.08
190 0.09
191 0.09
192 0.09
193 0.09
194 0.09
195 0.1
196 0.1
197 0.11
198 0.1
199 0.08
200 0.09
201 0.1
202 0.11
203 0.12
204 0.13
205 0.12
206 0.14
207 0.14
208 0.13
209 0.13
210 0.14
211 0.13
212 0.13
213 0.13
214 0.13
215 0.13
216 0.18
217 0.19
218 0.19
219 0.23
220 0.27
221 0.28
222 0.28
223 0.27
224 0.22
225 0.24
226 0.23
227 0.2
228 0.17
229 0.22
230 0.24
231 0.25
232 0.31
233 0.29
234 0.31
235 0.3
236 0.33
237 0.32
238 0.33
239 0.32
240 0.27
241 0.29
242 0.28
243 0.31
244 0.29
245 0.24
246 0.2
247 0.2
248 0.2
249 0.18
250 0.15
251 0.11
252 0.07
253 0.07
254 0.07
255 0.07
256 0.06
257 0.06
258 0.05
259 0.06
260 0.06
261 0.07
262 0.08
263 0.08
264 0.09
265 0.09
266 0.09
267 0.09
268 0.1
269 0.08
270 0.08
271 0.08
272 0.07
273 0.08
274 0.08
275 0.08
276 0.08
277 0.09
278 0.09
279 0.09
280 0.09
281 0.08
282 0.08
283 0.07
284 0.07
285 0.05
286 0.06
287 0.05
288 0.05
289 0.06
290 0.06
291 0.06
292 0.06
293 0.06
294 0.06
295 0.07
296 0.08
297 0.09
298 0.14
299 0.16
300 0.19
301 0.2
302 0.26
303 0.26
304 0.26
305 0.27
306 0.23
307 0.25
308 0.23
309 0.21
310 0.18
311 0.17
312 0.17
313 0.14
314 0.13
315 0.09
316 0.09
317 0.09
318 0.06
319 0.06
320 0.06
321 0.07
322 0.09
323 0.1
324 0.1
325 0.13
326 0.15
327 0.15
328 0.16
329 0.17
330 0.16
331 0.17
332 0.17
333 0.14
334 0.13
335 0.12
336 0.12
337 0.09
338 0.08
339 0.08
340 0.11
341 0.13
342 0.15
343 0.21
344 0.22
345 0.23
346 0.27
347 0.27
348 0.27
349 0.26
350 0.24
351 0.2
352 0.18
353 0.17
354 0.13
355 0.13
356 0.1
357 0.08
358 0.09
359 0.07
360 0.08
361 0.09
362 0.12
363 0.13
364 0.16
365 0.18
366 0.22
367 0.27
368 0.35
369 0.44
370 0.43
371 0.49
372 0.49
373 0.53
374 0.54
375 0.56
376 0.51
377 0.45
378 0.46
379 0.43
380 0.47
381 0.45
382 0.42
383 0.35
384 0.32
385 0.29
386 0.31
387 0.28
388 0.23
389 0.2
390 0.18
391 0.2
392 0.21
393 0.23
394 0.21
395 0.21
396 0.2
397 0.2
398 0.19
399 0.19
400 0.18
401 0.16
402 0.14
403 0.14
404 0.13
405 0.12
406 0.12
407 0.1
408 0.09
409 0.08
410 0.07
411 0.08
412 0.08
413 0.09
414 0.1
415 0.12
416 0.14
417 0.14
418 0.15
419 0.19
420 0.19
421 0.19
422 0.18
423 0.17
424 0.17
425 0.17
426 0.15
427 0.1
428 0.1
429 0.09
430 0.09
431 0.08
432 0.07
433 0.07
434 0.08
435 0.07
436 0.07
437 0.06
438 0.06
439 0.07